KEGG   Lactobacillus plantarum WCFS1: lp_0609Help
Entry
lp_0609           CDS       T00115                                 

Gene name
gltX
Definition
glutamate-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lpl00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
579545..581035
Genome map
AA seq 496 aa AA seqDB search
MAKSKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGKFILRIEDTDLKRNVKDGEKSQ
MDNLTWLGIDWDEGPDKGGDFGPYRQSERKSIYDPLIQQLIDEGKAYESYMTEDELSAQR
EAQKARKEMPHYVYEFAGMTEDEKQAKIAAAKAAGIQPVIRFHVPENTTYAWDDMVKGKV
SFESKTVGGDFVIKKRDGMPTYNFAVVVDDHMMEISHVFRGDDHVANTPKQLMIYEAFGW
QPPKFGHMSLIINTETGKKLSKRDETVLQFIEQYRELGYLPEAMLNFIILLGWSPVGESE
LFSKREFIKMYDEKRLSKSPAAFDGKKLEWVNNQYIKKADENEVFAMSIRQLIKAGRLPQ
RPDMSQIEWTRTLVSLFKNQMSYTGQIVDLADLFFNGPADINDEAKAELDNDTALPVLKE
FRQRIEDIDVFEATAIQKTIKSIQKDTKIKGRALYMPIRIAVSHEMHGPELPETIELLGR
ETTKKHLDAMIAELAK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaagagcaagattcgtgtgcgttacgcaccaagtccaactggccatttacacatt
ggtaatgctcggactgcattgtttaactatttatttgcccggcataataagggaaagttc
attcttcggattgaagacaccgatttaaagcggaatgttaaagacggtgaaaagagtcag
atggacaatttgacgtggttagggattgattgggacgaaggtccggataagggtggcgac
tttggcccttaccgtcaatcagaacggaaatcaatctatgacccgttgattcaacaatta
attgatgaaggtaaagcttacgaatcttacatgacggaagacgaattgtcggcacaacgt
gaagctcaaaaagcgcgtaaggaaatgccacactacgtctacgaatttgctggcatgacg
gaagacgaaaaacaggcgaagatcgcggctgctaaggcggctggtatccaacccgttatt
cgcttccacgtcccagaaaatacgacctatgcttgggatgacatggttaaaggtaaagtt
tcgtttgaatccaagacggttggtggcgactttgtcatcaagaagcgtgacgggatgcca
acgtacaactttgcggtggttgttgatgaccatatgatggaaattagccacgtcttccgt
ggtgatgaccacgttgccaacacgcctaagcaattgatgatttatgaagcctttggttgg
caaccaccgaagtttggccacatgagcttaattatcaataccgaaaccggtaagaagtta
agcaagcgtgacgaaaccgtattgcaatttatcgaacaataccgtgaattgggttactta
ccagaagcaatgcttaacttcatcatcctactaggatggtcaccagttggcgaaagtgaa
ttgttcagtaagcgcgaattcatcaaaatgtatgatgaaaagcggttgagcaagtcacca
gcagcttttgatggcaagaagttggaatgggtgaacaaccagtacattaagaaggctgac
gaaaatgaagtctttgcaatgtcaattcgccaattgatcaaggctggccggttaccacaa
cgcccagatatgagccagattgaatggacacggacgttggtttcattatttaagaaccag
atgagctatactggtcaaatcgttgatttagcagatctcttcttcaatggtccggctgat
atcaatgatgaagctaaggccgaacttgataatgacacggcactccctgtcttgaaggaa
ttccggcaacgaatcgaagatattgacgtcttcgaagcaaccgcaattcaaaagacgatc
aagagcattcaaaaggatacgaagatcaagggccgggcattatacatgccgatccggatc
gccgtttctcacgaaatgcacgggccagaattaccagaaacgattgaattattagggcgt
gaaacgaccaagaagcatctcgatgctatgattgcggaactcgccaagtaa

DBGET integrated database retrieval system