KEGG   Lactobacillus plantarum WCFS1: lp_0618Help
Entry
lp_0618           CDS       T00115                                 

Definition
(RefSeq) cell surface hydrolase
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF915 PGAP1 Abhydrolase_6 Abhydrolase_1 DUF900 Hydrolase_4 LCAT CmcI
Motif
Other DBs
NCBI-GeneID: 1061621
NCBI-ProteinID: YP_004888612
UniProt: F9UL83
Position
586639..587520
Genome map
AA seq 293 aa AA seqDB search
MAEVILVIIGALVLGILGRITFKFWQYGRPQHLRQSVSANSADDSAVTLFIPGYAGNRFS
FGGMLQRFTAGGIANKSLVVMIDRHNHPHVTGELDAYRPMVQLIFATPRVAVRQQAAGVL
AVVQYLIAHEHVQTINLVAHSMGGVVLFQYLTTAAKLVNLPEVRKVVTIGAPFNDSEVGQ
NTYPIENHPLTATGPTKTTPVYNYFLRTLQRLPNTISYLNIAGNIGDAAQSDGAVALNSA
LSLRFLLRPTRDQYQEFVVHGKNARHSRLHENYEVDRQIVQFFISRSHKKGCW
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggcagaagtaattttagtcatcatcggcgccttagtgctcggtattttggggcgtatc
acctttaaattttggcaatacgggcgaccgcagcatttgcggcagtcggtgtcggctaat
tcagcagatgatagcgccgtgacgctatttattccagggtatgcgggcaaccggttctct
tttggtggcatgctccaacgttttacggccgggggcatcgccaataagtcattagtcgta
atgattgatcgacataatcatccccatgtgactggtgagctagacgcttaccgcccaatg
gtacagttgatttttgccacgccacgcgttgctgtacggcaacaggcggcgggcgtcttg
gcagttgtgcagtatttgattgcgcatgagcacgttcagacgatcaatttagtcgctcat
tcgatgggtggtgtggtgctctttcaatacttgacgacagctgccaaactggtcaattta
ccggaagtccgcaaggttgtcacaattggtgcgccgtttaatgatagtgaggtcgggcag
aatacgtatccgattgaaaaccacccgttgacggcgaccggaccaactaagaccacgccc
gtttataattattttttgcgaacgctccaacgattgccaaacacgatttcgtatttgaat
attgcgggtaacattggcgatgcggcgcaaagtgatggtgctgtcgctctgaatagtgcg
ttgtcattgcgctttttactgcgaccgacgcgtgaccagtatcaagaatttgtggtacat
ggtaagaatgcccgccattcacgattacatgaaaactatgaagttgatcgccaaatcgtc
cagttttttatatccagaagccacaaaaaaggttgctggtga

DBGET integrated database retrieval system