KEGG   Lactobacillus plantarum WCFS1: lp_0619Help
Entry
lp_0619           CDS       T00115                                 

Gene name
rplK
Definition
(RefSeq) 50S ribosomal protein L11
  KO
K02867  
large subunit ribosomal protein L11
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    lp_0619 (rplK)
Ribosome [BR:lpl03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    lp_0619 (rplK)
  Bacteria
    lp_0619 (rplK)
  Archaea
    lp_0619 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
587629..588054
Genome map
AA seq 141 aa AA seqDB search
MAKKVANVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGMIIPVVITV
YEDRSFDFITKTPPAAVLLKKAAGVESGSGEPNTKKVATVTKDQVKQIAETKMQDLNAAD
VEAAMRMIEGTARSMGFTVEG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaaaaagtagctaacgttgttaaattacaaattcctgcgggcaaagcaacacct
gctccgccagttggcccagctttaggtcaagcaggtatcaatatcatgggtttcacaaag
gatttcaatgctcgtactgctgatcaagcaggtatgatcatccctgttgtgattacggtg
tacgaagatcgttcattcgacttcatcactaagaccccacctgctgccgttctattgaag
aaagctgccggtgttgaaagtggttccggtgaacctaacacgaagaaggttgcaactgta
accaaagatcaagttaagcaaatcgccgaaactaaaatgcaagatctaaacgcagctgac
gttgaagcagctatgcgcatgatcgaaggtactgctcggagtatgggattcaccgtcgaa
ggctaa

DBGET integrated database retrieval system