KEGG   Lactobacillus plantarum WCFS1: lp_0757Help
Entry
lp_0757           CDS       T00115                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    lp_0757 (galU)
   00052 Galactose metabolism
    lp_0757 (galU)
   00500 Starch and sucrose metabolism
    lp_0757 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    lp_0757 (galU)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     lp_0757 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691786..692706
Genome map
AA seq 306 aa AA seqDB search
MSKVRKAVIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVDEARKSGIEDIVIVTGKS
KRSIEDYYDSNPELEDNLRAKHKEEMLKLVQETTDINLYFIRQSHPRGLGDAVLTAKAFV
GDEPFVVMLGDDLMEDKVPLTKQLMNSYDKTHASTLAVMKVPHEEVSKYGVINPESEKEP
GLYNVNNFVEKPSPEDAPSDLAIIGRYLLTPEIFDVLENQKPGKGDEIQLTDAIDTLNKT
QRVFAHEFKGTRHDVGYKFGYLKTTIEYGLTHPDVKADLRTYIKDLGAKLSKEDSAAPKT
TKKPTK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttagaaaagccgttatcccagcggccggattaggaacacggtttttgcct
gctactaaggcgatgcctaaagaaatgttaccaatcgttgataaaccaacgattcagttc
attgttgacgaagctcgtaaatcggggatcgaagacattgttatcgtcacgggtaagagc
aagcgtagtattgaagattactatgattctaacccagaattagaggataacttacgggct
aagcacaaggaagaaatgctcaagctggttcaagaaaccacagacattaacttgtacttt
atccggcaatcacacccacgtggtttgggcgatgccgttttaacggctaaagctttcgtt
ggtgacgaacctttcgtcgtcatgcttggtgatgatttaatggaagacaaagtaccgtta
accaaacagttaatgaatagctatgacaagacacatgcgtcaacgttagctgttatgaag
gttcctcatgaggaagtttctaagtatggggttatcaatcctgaaagtgaaaaggaaccg
ggcctatacaacgttaataactttgttgaaaagccatcacctgaagacgcgcctagtgat
cttgctatcattggtcgttacttattaacaccagaaatttttgatgttcttgaaaaccaa
aaacctggtaagggtgacgaaattcaattgacggatgccattgatacgttgaacaagact
cagcgggtctttgcccatgaatttaaggggactcggcacgatgttggctacaagtttggc
tacttgaagacgacgatcgaatacgggttaactcatccggatgttaaggctgacttgcgg
acttacatcaaggatcttggtgctaagttatctaaagaagatagcgccgctcctaaaaca
acgaagaaaccaactaaataa

DBGET integrated database retrieval system