KEGG   Lactobacillus plantarum WCFS1: lp_0834Help
Entry
lp_0834           CDS       T00115                                 

Gene name
gykA
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    lp_0834 (gykA)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     lp_0834 (gykA)
Exosome [BR:lpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lp_0834 (gykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(772280..773806)
Genome map
AA seq 508 aa AA seqDB search
MSAKYIMAIDEGTTSTRTIIFNHAGQKVADAQKEFPQYFPQPGWVEHDATEIWNAVSSTI
ANVLIDANIKPNQIEAIGITNQRETTVVWDKQTGLPIYNAIVWQSRQTAPLAEQLIADGM
GDLIHRHTGLVTDAYFSATKIRWILDHVDGAQKRAERGELLFGTIDTWLVWKLTGGETHV
TDYTNASRTMLFNIHDLQWDQTILNLLNIPAAMLPEVRSNSEIYGTTKDYLLYGSQIPIS
GMAGDQQAALFGQMAFEPGMVKNTYGTGAFTVMNLGEQPQLSDHNLLTTIAYGLDGNINY
ALEGSIFVAGSALQWLRDGMQLIESAPESESLAQQSHNHNEVYVVPAFTGLGAPYWDSET
RGAVFGLTRGTTRADFVKATLQSLAYQSRDVIDTMKNDANITMPTLMVDGGAARNNWLMQ
FQADISNVKIIRAADLETTALGAAFLAGLAVGYWQDLDELKSIHQTGNVFQPRMAAPQRA
NLYQGWQAAVKAAQLFKHTPIDAQSSTN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaaatatatcatggccattgacgaggggaccacgagtacccgcaccattatt
tttaatcacgccggtcaaaaagttgccgacgcccaaaaggagtttccacaatactttccg
caaccggggtgggtcgaacacgacgctactgaaatctggaacgcggtttcctcaacgatc
gctaacgtcttaattgacgctaatattaaacctaatcaaatcgaagccatcgggatcacc
aatcaacgtgagactaccgttgtctgggacaagcaaaccggtctacccatttataacgcc
attgtttggcagtcccggcaaactgcaccgttagctgagcaactcatcgctgatggtatg
ggcgatctgattcaccggcacaccggcctagtgaccgacgcctacttctcagcaacgaaa
attcgctggatcttagaccacgttgatggtgcccaaaagcgcgcggaacgcggcgaactt
cttttcgggactattgatacttggctcgtctggaaattgactggtggcgagacccacgtc
accgactacaccaacgccagtcgcaccatgttattcaacattcacgacttacaatgggac
caaacgattctgaacctactgaacattcctgctgcgatgctcccagaagtacggtccaac
tctgagatctatggcacgactaaggactacttgctttatggtagccaaattccaatcagc
gggatggccggcgaccaacaagccgcactatttggtcagatggcctttgaacctggcatg
gtcaaaaatacttatggaaccggtgcctttaccgtcatgaatctgggcgagcaaccgcaa
ttatccgaccacaaccttttaacgaccatcgcttacgggcttgatggcaacatcaattac
gcgcttgaaggctccatcttcgtagcgggttcggccctgcaatggttacgcgatggtatg
caactgatcgaatcagcaccagaatccgaaagtcttgcccaacagtcccataatcacaac
gaagtttacgtagttcccgccttcaccggattgggcgcaccttactgggattccgagacc
cgtggagccgtctttggcttaacccgcgggaccacccgggctgattttgttaaagccacg
ctacagtcactggcctaccagtcccgcgacgtcattgatacgatgaaaaacgatgccaac
atcaccatgcccacactcatggtcgacggcggggcagcccgcaacaactggctgatgcaa
tttcaagccgacatctcaaatgtcaagatcatccgggccgctgacctcgaaacgaccgca
ctcggtgctgcattcttagccggcctagccgtgggatactggcaagatttggacgaactc
aaatcaatccaccaaaccggcaatgtcttccaaccccgaatggccgcgccccaacgtgcg
aacctttaccaaggctggcaagccgccgtcaaagcagcccaactattcaagcacacccca
atcgacgcccaatcaagtaccaactaa

DBGET integrated database retrieval system