KEGG   Lactobacillus plantarum WCFS1: lp_0857Help
Entry
lp_0857           CDS       T00115                                 

Gene name
pepX
Definition
Xaa-Pro dipeptidyl-peptidase
Orthology
K01281  
X-Pro dipeptidyl-peptidase [EC:3.4.14.11]
Organism
lpl  Lactobacillus plantarum WCFS1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(797481..799922)
Genome map
AA seq 813 aa AA seqDB search
MKNNQFAIVPTDSETAIAELTKIHFITPDMDALTTVPAVYQALLAKSLPEVHTASGLTHK
FNNIMATSQHTLSEWLADATIVNNQVFYNVGLQLLGFLPGQDFELADPLLAMRDIHLPMV
GDSAFDREALYYAWYLLLNTRGNNGQTLIESLTTRGYFVPFYQLPNDQKPLFFNGKAQAV
FDTNALIRDVVYVEAPLDTDHDGQRDLLKVEILRPAETETGLKVPVLYTASPYNQGINDQ
AGDAQMHNVDVPLTAKEPDENTYADVEFQPTTAQLPAARTATTTTDTAEETFSREKSYTL
NDYFLARGFAVVYAAGIGSIDSDGLAPTGDVDETTSTVAIIEWLTGKRQAFTNRDGNIAI
KAWWCNGAVAMTGRSYLGTLATAAATTGVAGLKTIISEAAISSWYDYYRDNGLVVAPDTF
QGEDTDVLAAEVFSRSLKAGDAHQIQPAFDQKLAELTADQDRASGNYNRFWDERNYLKNV
DKIKADIIMVHGLNDWNVKPRNVANLWDKLQAVPVTKKLILHQGQHIYINNLQSLDFTDM
MNLWLSHKLYGLDNHAETLLPNVLVQDNTQAQTWHGYDNWWQDTTDALDFKVQYKELVPA
DHTVDQRAAHFTDKLPDKLFDHYKHHLDSWQRDLLQEDKLNPLYDHRLLFKSWQAPEDQL
LVGIPHVAGSVAVNKNFGMLSFMLIDFGAARRLTVSPQILAAKALDLGYHWREDDLKDFK
LAGETPFKMITKGHLNLQNRHHPWHAEAIQPNVFYDFSVDLQPLFHHLLKGHQLGLVIYA
TDMKMTIRGNQDLQYSLNLNDIRLHVPMKKITD
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataatcaatttgcaatcgtcccgactgattcggaaaccgcgattgccgaactt
acgaaaattcattttattacgcctgatatggacgccctgacgactgttccagccgtctac
caggcattgctagctaaaagcttaccagaagtccacacggcaagcggcttgacccacaag
tttaataacatcatggcaaccagccagcacactttatcagaatggctcgccgatgcaact
atcgtgaacaatcaagtcttttataatgtgggacttcagttactgggttttctacctggt
caagattttgaattggccgatccattgctggcgatgcgcgatattcacttgccaatggtc
ggtgatagcgcctttgatcgtgaagccctctattatgcttggtacctattattaaataca
cgtgggaataatggacaaaccttgattgaatcactcacgacccggggttactttgtacca
ttttaccaattacctaacgatcaaaagccactcttcttcaatggtaaggcccaagccgtc
tttgataccaacgcgctcattcgtgacgtcgtctacgttgaagcgcctttagatactgac
cacgacggccaacgggacctgctcaaagttgaaatccttcggccagctgagaccgaaacc
ggcttaaaagttcccgttctctataccgctagtccttataatcagggcatcaacgaccaa
gctggcgatgctcaaatgcacaacgtagacgttcccctgactgcaaaggaaccggacgaa
aatacctatgcggatgttgagttccagccaacaacggcgcaactaccagccgctcgaacc
gcgaccacgacgaccgatacagcagaggagactttcagccgagaaaagtcctacacgctc
aatgattactttctagcgcgcggttttgctgtcgtctatgcagctggaatcggttcgatc
gactcggatgggctagcccctaccggtgacgttgatgaaacgacctcaacagttgcaatt
attgaatggttgactggcaaacgccaagccttcaccaatcgtgatggcaatatcgctatc
aaagcttggtggtgcaacggcgccgttgctatgactggccggtcttacctcggtaccctc
gcaactgccgctgctacgacgggcgtggctggccttaagacgattatttccgaggccgcc
atctcaagctggtacgactattatcgagataatggcctggttgtcgctcccgatacgttc
cagggcgaagacaccgatgttctcgccgctgaggtcttctcacgaagcttaaaagccggt
gacgctcaccagatccaacccgcgtttgatcagaaactggcagaactgactgccgaccaa
gaccgagcaagcggtaactataaccgtttctgggatgaacgcaattatctcaagaacgtt
gacaaaattaaggcggacatcatcatggttcacgggctcaacgactggaacgttaagccc
cgaaacgtagctaatttatgggataaattacaggcagttcccgttactaaaaagctcatt
ttgcaccagggacaacatatttatatcaataacttacaatcgctcgatttcaccgacatg
atgaacttgtggctaagccataaattatatggtttagataatcatgcggagacactcttg
cctaacgtcttggtacaagacaacacgcaagcccaaacttggcacggctatgacaattgg
tggcaagacacaaccgacgctttagattttaaggttcagtacaaagaattagttcctgct
gaccatacagttgaccaacgcgccgctcattttactgataaattgcctgacaaattattc
gaccactataagcatcatttggatagttggcagcgcgacctcttgcaagaggataagtta
aatccgctctatgatcaccgcctcttgttcaagtcttggcaggcacctgaggatcaatta
ttagtgggtattccgcacgttgcgggctctgtcgccgttaataagaatttcggcatgttg
agctttatgctgattgacttcggggccgcgcgccgtttgactgtcagcccacaaatactg
gctgcaaaagcgcttgatctaggttaccactggcgcgaagatgatttgaaggacttcaag
ttagcgggtgagacgccgttcaagatgattactaaggggcatcttaacttacagaaccgt
caccacccatggcacgcagaagcgattcagccaaatgtcttttatgacttttctgtggat
ctccaaccgctgttccaccacttactgaaggggcatcaactcggactagtcatttacgca
actgatatgaagatgacgatccgcggcaatcaagacctacagtactcacttaacttgaac
gatattcgcttacacgtcccaatgaaaaaaataacagactaa

DBGET integrated database retrieval system