KEGG   Lactobacillus plantarum WCFS1: lp_0866Help
Entry
lp_0866           CDS       T00115                                 

Gene name
gmk2
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lpl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805431..806012
Genome map
AA seq 193 aa AA seqDB search
MTTKRIFVITGPTGSGKTTVSHYLRSQYQIPQVITHTTRAPREGEVGGRDYYFETPASFV
TKHYLEHVTYSGNQYGSSREGLAAAWERSPLISIVLDTAGAITYARELGEQAVVIYLEVA
DQEALIQRLTKRGDLPSRIKKRVASDEYLRDQALPVGLVGHAHVIVNDDWQATRRQLDEL
VTEYCQHDVVTKD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgacaacgaaacggatctttgtgatcacgggaccaacggggagtggtaagaccactgtc
agtcattacttgcggtcacaataccaaattcctcaggtgattactcatacgacccgggct
ccccgggaaggtgaagtcggtgggcgcgactattattttgaaactccggcgagttttgtc
acgaaacattatttagaacacgtgacctatagtggtaatcaatacggttcttcacgagaa
ggactagcggcagcctgggaacggtcaccactgattagtatcgtcttagatacggcgggg
gctattacctatgcgcgggagttgggcgaacaagcggtggtgatttatctcgaggttgct
gatcaagaggcgctaattcagcgtttgaccaagcgaggagatcttcctagccggataaaa
aagcgagttgctagtgatgagtatttgcgggaccaggctttgccagtaggattagtgggg
catgcacatgttatcgtgaatgatgattggcaggcgacgcggcgccaactagatgagctg
gtcactgaatattgtcagcatgatgttgtgacgaaagattag

DBGET integrated database retrieval system