KEGG   Lactobacillus plantarum WCFS1: lp_0866Help
Entry
lp_0866           CDS       T00115                                 

Gene name
gmk2
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lp_0866 (gmk2)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     lp_0866 (gmk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805431..806012
Genome map
AA seq 193 aa AA seqDB search
MTTKRIFVITGPTGSGKTTVSHYLRSQYQIPQVITHTTRAPREGEVGGRDYYFETPASFV
TKHYLEHVTYSGNQYGSSREGLAAAWERSPLISIVLDTAGAITYARELGEQAVVIYLEVA
DQEALIQRLTKRGDLPSRIKKRVASDEYLRDQALPVGLVGHAHVIVNDDWQATRRQLDEL
VTEYCQHDVVTKD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgacaacgaaacggatctttgtgatcacgggaccaacggggagtggtaagaccactgtc
agtcattacttgcggtcacaataccaaattcctcaggtgattactcatacgacccgggct
ccccgggaaggtgaagtcggtgggcgcgactattattttgaaactccggcgagttttgtc
acgaaacattatttagaacacgtgacctatagtggtaatcaatacggttcttcacgagaa
ggactagcggcagcctgggaacggtcaccactgattagtatcgtcttagatacggcgggg
gctattacctatgcgcgggagttgggcgaacaagcggtggtgatttatctcgaggttgct
gatcaagaggcgctaattcagcgtttgaccaagcgaggagatcttcctagccggataaaa
aagcgagttgctagtgatgagtatttgcgggaccaggctttgccagtaggattagtgggg
catgcacatgttatcgtgaatgatgattggcaggcgacgcggcgccaactagatgagctg
gtcactgaatattgtcagcatgatgttgtgacgaaagattag

DBGET integrated database retrieval system