KEGG   Lactobacillus plantarum WCFS1: lp_0906Help
Entry
lp_0906           CDS       T00115                                 

Gene name
pbg2
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_0906 (pbg2)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     lp_0906 (pbg2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
835697..837199
Genome map
AA seq 500 aa AA seqDB search
MDVYKTSPNFMWGVATAANQVEGAWNEDGKGMSIADCLRYRPQIDSSDYQAVNQMDSAEI
ENALNDESTKGWAKRHGVDFYHHYREDIKQLAETGINTYRFSISWARIFPNGDDKCPNQA
GLDFYLSLVKELAKYQITPVVTLSHYEMPLNLVLNYDAWYDRRVADFFGRYARTVIDYLH
DYVKYWIPINEIDSIIRHPFSSAGLVADRFASHDFKTVIYQAMHHQFVAAAQVVKYCHRH
YPQMQVGSMITRTMVYPYNSDPNNVLAATQTMREVYAFSDIQVRGEYPEFLLTKLKKAHI
TIEFQEGDQEVLRENTADFVAFSYYSSICTASNVEGLRVTKANRTVGVYNRYLPESEWGW
QIDPVGLRLSLIDLFDRYQKPLFIVENGLGAVDELSSDLRVHDIYRISYLRQHIRQMLIA
IANDGVDLMGYCMWGTTDMISASSNQMSKRYGLIYVDLDDNGDGSYNRYLKDSYFWYQEL
LSYKNQIPAIFLDENSIVIQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttacaaaacgagtcctaactttatgtggggcgtagcaactgctgctaatcaa
gtagaaggcgcatggaacgaggacggtaaaggcatgtctattgcagattgcctgcgttat
cggccgcaaattgatagtagtgactatcaagcggtgaaccaaatggatagtgctgaaatt
gaaaacgccttaaatgatgaatcgactaaaggttgggcaaaacggcatggtgtggatttt
tatcatcattatcgagaagatattaaacagttggcagagacaggaatcaatacctatcga
ttctcgataagttgggcccgtatttttccaaatggtgacgataagtgtcctaatcaagcg
gggttagacttctacctgtcactagttaaagaattggcaaagtaccaaattacaccagtg
gtgacgctatcccactacgaaatgccgttaaacttagtgctaaattatgatgcttggtat
gatcgacgagtggcagacttttttgggcgttatgcgcgaaccgtcattgattatttacat
gattatgtcaagtactggattccgattaatgaaattgacagtattattaggcacccattc
tcatcagctggattagtcgcagatcgttttgctagtcatgattttaaaacggttatttat
caagcaatgcatcatcagtttgtggcagcggcacaggttgtcaagtattgtcatcgtcac
tatccacagatgcaagttggtagcatgattactagaacgatggtttatccatataatagt
gatcccaataatgtgcttgcagcaacgcaaacgatgcgtgaggtgtatgcatttagcgat
attcaagtgcgtggagaataccctgaattcttgttaactaagctgaaaaaagcacatatt
acgattgaatttcaggagggtgatcaggaagtactacgtgagaatacggccgattttgtg
gcctttagttactactcctcaatttgcacggctagtaatgtggaaggcctgcgggtgacc
aaggctaatcgaaccgttggcgtttataatcggtacttgcctgagagtgagtgggggtgg
cagattgatccagttggattgagactatctttaatcgatttgttcgatcgctaccaaaag
ccgttattcattgtcgaaaatggcctaggtgctgtggatgagttgagcagtgatcttcgt
gttcatgacatatatcgaatcagttacttgcgccagcacattcggcagatgttaatagcc
attgcgaatgatggtgtggacttaatggggtactgtatgtggggaaccaccgatatgata
tctgcgtcgtcaaaccaaatgtcaaagcggtatggtttaatctatgttgacttagatgat
aatggtgatggctcatataatcgatatttaaaggacagttatttctggtatcaagaatta
ctaagctataagaatcaaattccagcaatttttttagatgaaaatagtatagtcattcaa
tga

DBGET integrated database retrieval system