KEGG   Lactobacillus plantarum WCFS1: lp_1188Help
Entry
lp_1188           CDS       T00115                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    lp_1188 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lp_1188 (rfbC)
Enzymes [BR:lpl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     lp_1188 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1085724..1086305
Genome map
AA seq 193 aa AA seqDB search
MGKLKVTTTKLQDVKIIEPAVFGDKRGFFTETYSDRDFKEAGIDFDFIQDNQSLSAEAGV
LRGLHFQRGKAAQTKLIRVVTGAVLDVIVDVRAGSPTYGEWEGYIISESNHRQLLVPRGF
AHGFVTLTDNVNFLYKCDNYYNAEADGGITFMDKDLNINWPIDYDQAITSDKDAKQQTFK
EFEQNNPFVYGEI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaattaaaggtaacaacgactaagttacaagatgttaagattattgaaccagca
gtttttggtgacaagcgggggttctttacggaaacctactctgaccgtgatttcaaagaa
gccggcattgattttgacttcattcaggataatcaatcattgtcagcggaagcgggtgtt
ttgcggggactgcattttcaacgtggcaaggcagcgcaaactaaattgattcgcgtagtg
actggcgccgtgcttgatgttattgtggacgttcgtgctggctcacctacgtacggggaa
tgggaaggctatattatctctgaaagtaaccaccgtcaattgttagtcccccgtggcttt
gcccatggctttgtgacattgactgataatgttaatttcttatacaagtgtgataactac
tacaatgctgaagctgatggtggaatcacctttatggataaagatttaaacattaactgg
cctattgactacgatcaagctattacttctgataaggatgctaaacaacagaccttcaaa
gaatttgaacagaataatccgtttgtttacggcgaaatttaa

DBGET integrated database retrieval system