KEGG   Lactobacillus plantarum WCFS1: lp_1401Help
Entry
lp_1401           CDS       T00115                                 

Gene name
pbg3
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_1401 (pbg3)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     lp_1401 (pbg3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1284342..1285814
Genome map
AA seq 490 aa AA seqDB search
MQFPADFYWGGATAANQCEGAYDVDGRGLTMKDITTMGGLNQRRQVTYLQADGTPGKGDS
IPAGAHGAVLPDDYYPNQTSIDFYHRYQEDIALFAEMGFKMYRMSISWSRIFPRGDENEP
NQAGLDFYRRVFETLKKYEIEPLVTISHFDMPLYLEETYGGWNDRRMIGFYQHYAETLFT
AYRGLVKHWITFNEINNTIMFLALRAKAGDADYQRAYQQLHYQFVASALAVQQAHAIDGE
NKVGCMICGITSYPLTCDPADVLQNRYVWEQNIYYCGDVQCQGQYPTYARRLWNEHQVDL
DITDSDLEALKAGTVDWYTFSYYMSTAVTTHEVSATVGGNFSMGARNPYLQYSEWEWADD
PAGLQYYLELMNDRYHLPLMVVENGLGAKDYLTVDGQIHDVYRISYLRKHIQAMATAIHH
GVKLIGYTSWGCIDLVSAGTGQMSKRYGLIYVDRQDDGSGTLARIPKDSFYWYQRVIASN
GQDLGPSASN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttccggctgatttttactggggtggggctactgccgctaatcaatgcgaaggt
gcttatgatgttgatggtcggggcctgactatgaaggatattacgacaatgggaggcctt
aatcagcgacggcaagtcacttatttgcaagcggatggtactcctggaaaaggggattca
attcctgctggagcacacggagcggtactgccagatgactattatcctaatcagactagt
attgacttctatcatcgatatcaagaagatattgcgctgtttgcagagatgggtttcaaa
atgtatcgaatgtcgatttcctggtcacggattttcccacgcggagatgaaaatgaacct
aatcaagcagggttggatttttatcgccgggtgttcgaaactttgaaaaaatatgaaatt
gaaccattggtgacgatttcacacttcgatatgccactgtatctggaggaaacgtatggt
ggctggaatgaccgtcgaatgattggtttttaccagcattatgcggaaacgctatttacg
gcgtatcgtgggctggtaaagcactggattaccttcaatgaaattaataatacaatcatg
tttctggcattgcgtgccaaagccggtgatgcagattaccaacgcgcttatcaacaatta
cattatcaatttgttgctagtgctttagccgtacagcaagcacatgcgattgatggcgaa
aataaagttggttgcatgatttgcggtatcacgtcttatccgttaacctgtgatccggcg
gatgtcttgcagaatcggtacgtctgggaacaaaacatctattactgtggtgatgtgcag
tgccagggacagtatccaacctatgcacgacgtttatggaatgagcatcaagttgattta
gacattacggacagtgatttagaagccttgaaagccggtacggttgactggtataccttc
tcgtattacatgtcaacggcagttacaacacatgaggtcagtgcaactgttggcggtaat
ttttcgatgggcgcgcgtaacccatatctacaatactctgaatgggagtgggcggatgac
ccggctggtctacaatattatttggagctgatgaatgatcgatatcatttaccactaatg
gttgttgaaaatggattgggtgccaaggattatttgacagtagatggtcaaatccatgat
gtataccggattagctatctacgtaaacatattcaagcaatggcaacggcaattcaccat
ggcgtcaaactgattggttataccagttggggctgtattgatttagtttctgcaggtaca
gggcaaatgtctaaacgatacggattgatttatgtggatcgtcaagacgatggtagtgga
actctggcccgaatcccgaaggactctttctactggtatcagcgagtgattgcatccaat
ggtcaagatctgggtccctcggcctcaaattaa

DBGET integrated database retrieval system