KEGG   Lactobacillus plantarum WCFS1: lp_1573Help
Entry
lp_1573           CDS       T00115                                 

Definition
bifunctional protein: transcription regulator; sugar kinase, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lp_1573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_1573
   00052 Galactose metabolism
    lp_1573
   00500 Starch and sucrose metabolism
    lp_1573
   00520 Amino sugar and nucleotide sugar metabolism
    lp_1573
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lp_1573
   00524 Butirosin and neomycin biosynthesis
    lp_1573
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lp_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1438502..1439464
Genome map
AA seq 320 aa AA seqDB search
MERKLIGVDLGGTTTKFAILTENGDIQQKWSIETTILDEGAHIVPNIIDSINHHIELYKM
DRSQFIGIGMGTPGTVDLDNGTVIGAYNLNWKTLQPVKAQIEKGTGIKFTLDNDANVAAL
GERWKGAGENGSDVVFVTLGTGVGGGIIADGRLLHGIAGGAGEIGHVTVEPNGYMCTCGK
KGCLEQYASATGVVHVARDMAEEFSGASKLKQLLDNGEEISSKITFDLAKEGDVLAKRVV
DRVSYYLGLALANVGNTMNPSSIIIGGGVSAAGDFLLDQVISYFNQFTFPTIRDTTALKL
AVLGNDAGVIGAGSLAQRFI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtaagttaatcggagtcgaccttggtgggacgacaactaagtttgccatttta
acagaaaatggtgatattcaacaaaagtggagtattgaaaccacgattttagatgaaggg
gcccacattgtgcctaacatcatcgattccatcaaccaccacattgagttatataagatg
gaccgttctcaatttatcggaattggaatggggactcccgggaccgttgatttggataat
ggtacggttatcggtgcctacaacttaaactggaagaccttacaaccagttaaggctcaa
atcgaaaaagggactggcatcaaatttacgctggataacgacgctaacgttgctgcactt
ggcgaacgttggaagggcgctggcgaaaacggtagtgacgttgtctttgtaacgcttgga
actggtgttggtggtgggatcatcgccgatggccgtttactccatggtattgccggtggt
gccggtgaaattggtcacgtaacggttgaaccaaacggctacatgtgtacttgtggtaag
aaaggttgtttggaacaatacgcttctgcaactggtgtcgttcacgttgctcgcgatatg
gcagaagaattctctggtgcttctaagttgaaacaattattagacaacggtgaagaaatt
agttcaaagatcactttcgatttagctaaagaaggcgatgtcttggctaaacgcgttgtt
gatcgggtttcttattacttaggcttggcattagctaatgtcgggaacacgatgaaccca
tcttcaatcattatcggtggtggggtttcagctgctggtgatttcttattagatcaagtc
atcagttactttaaccaattcacattcccaacgattcgcgacacgactgctttgaagtta
gcggtcttaggtaacgacgctggtgttatcggagcaggttcattggcccaacggtttatt
taa

DBGET integrated database retrieval system