KEGG   Lactobacillus plantarum WCFS1: lp_1631Help
Entry
lp_1631           CDS       T00115                                 

Gene name
rnc
Definition
(RefSeq) ribonuclease III
  KO
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     lp_1631 (rnc)
Messenger RNA biogenesis [BR:lpl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     lp_1631 (rnc)
Ribosome biogenesis [BR:lpl03009]
 Eukaryotic Type
  90S particles
   RNase
    lp_1631 (rnc)
 Prokaryotic Type
  rRNA processing factors
   lp_1631 (rnc)
Chromosome [BR:lpl03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     lp_1631 (rnc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1484497..1485192
Genome map
AA seq 231 aa AA seqDB search
MITELAAMLKERFGIVFNDPDLLAEAFTQASYVNEHQDQQLKYYERVEFLGDAVLELVVS
EYLYKRYKDMPQGKLTRLRAAMVCEESFASFARECDFPQYIRLGKGEQKAHAWERDSLLC
DIFESFVGALYLDQGREPVLKFVHQVIFPKLDEGRFDGVFDYKTTLQEYLQRDGDVAIDY
QLIEQDGPANERSYEIAVLADGQKIGEGWGHSKKEAEQSAARQAYSQLQQK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaattagctgcaatgttgaaggaacggtttggcattgtgtttaacgatccc
gatttattggcggaggcgtttacacaagcctcgtatgtcaatgaacatcaggaccaacag
ttgaagtattacgaacgggtcgaatttttgggggatgccgtcttggagttagtggtgtcc
gaatatttatacaaacgttataaagacatgccccaaggtaagttgactcgtttacgggcc
gccatggtttgtgaagaaagttttgcaagctttgcccgtgaatgtgactttcctcagtac
atccggttaggcaagggcgaacaaaaagcgcatgcttgggaacgagattcacttttatgt
gatatttttgaatcatttgtcggggcactgtacctggatcaaggacgggaacctgttttg
aagttcgttcatcaagtaatttttcctaagctggatgagggtcgttttgatggtgttttt
gattataagacgaccttgcaagaatacttgcaacgggatggcgatgtcgcaatcgactat
caattaattgaacaagatggtccagccaatgagcggtcttatgagattgccgtacttgcc
gatggtcaaaaaatcggtgagggctgggggcattccaagaaggaagccgaacagagcgct
gctcggcaagcttattcacaattacagcaaaagtaa

DBGET integrated database retrieval system