KEGG   Lactobacillus plantarum WCFS1: lp_1655Help
Entry
lp_1655           CDS       T00115                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp_1655 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp_1655 (trpC)
Enzymes [BR:lpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     lp_1655 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1509816..1510598
Genome map
AA seq 260 aa AA seqDB search
MILDQLVQASQQRVQKVPVRERVKRIQQARKMTTPVLSFEAMLAQPGLQLIGEVKRASPS
KGLIAAEFDYLQIAQDYVAAGIDAISVLTEPRYFKGQLSYLQAITQTVSVPTLRKDFIVA
ASQIASARIAGASAVLLIVAILTPVQLQAFITLAHELNLSALVEVHTTAESKQAVAAGAR
IIGINNRNLKDFSVNFATSCQLRQAVPAECYVVAESGIQTATQAQQLAAAGFDAMLVGET
LMRAPDKGQAVMQLRAGVRG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatcaactcgtccaggcgagtcagcaacgggttcagaaggtgccagttagg
gagcgtgtgaagcgcattcaacaagctcgaaaaatgaccacccccgttttatcatttgaa
gcaatgctggcccagccgggcttacagcttattggtgaagttaagcgggcgtcaccttct
aaggggctgattgcggctgagtttgactatttacagattgcgcaagactatgttgctgct
gggatcgatgccatctcagtgttgaccgaaccccggtattttaaaggacagttgtcttac
ttacaagccattacgcaaacggtctcggtacccacattacgtaaagattttattgtggct
gctagtcagattgcgagtgctcgtattgctggtgctagtgcggttttattgattgttgct
attttaacaccggttcaactgcaggctttcattacgttggctcatgagctgaatttaagt
gcgctagttgaagtccatacaacggctgagagtaagcaagcggtggcggctggggcccgg
attattggcattaataatcggaatttgaaagatttcagtgtcaattttgcaacgagctgt
cagttacggcaagcagttccagctgagtgttatgtggtcgctgagtctggtattcaaacg
gccacacaggctcaacagttggccgctgctggctttgacgccatgctagttggcgaaaca
ttgatgcgtgcaccagataaaggtcaagccgtcatgcaattgcgggcgggggtgcgtgga
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system