KEGG   Lactobacillus plantarum WCFS1: lp_1657Help
Entry
lp_1657           CDS       T00115                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp_1657 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_1657 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp_1657 (trpA)
Enzymes [BR:lpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lp_1657 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1511223..1512422
Genome map
AA seq 399 aa AA seqDB search
MIKNQSQAGRYGDFGGQYVPETLMTELQRLDRAFQHYRQDAHFQEELTDLLNNYANRPSL
LYHAQRLSDQLGGAQIYFKREDLNHTGAHKINNVLGQALLAKKMGKKRLIAETGAGQHGV
ATATIAALFGMECDVFMGKKDTNRQALNVYRMQLLGAKVHPVTTGSMVLKDAINAALQEW
TRRCDDTAYIMGSATGPHPFPMMVHEFQSVISVEARQQILDQTGHLPDAVVACVGGGSNA
IGSFAAFLDDTSVELIGCEAAGKGVQTPLTAATIERGRTGIFHGMKSLFLQDKAGQIAPV
YSISAGLDYPGVGPEHAYLAASGRAQYVGINDDQAVQAFELIAKVEGVICAIESAHAVAY
VQQLAPTMRRDQTIICTLSGRGDKDVAAIAKYRGVTIDD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatcaatcacaggcggggcgttacggcgactttggtggtcagtacgttcca
gaaacattaatgaccgagctacagcggttggatcgcgcctttcaacattaccgacaggac
gcgcattttcaagaagagttgactgacttgttgaataactatgcgaaccggccatcgttg
ttgtaccatgcacaacgattatcagatcaattaggtggtgctcagatttattttaaacgt
gaggacttgaaccatacgggtgcgcacaagattaacaatgtcttggggcaggcactgttg
gcaaagaagatgggcaaaaagcgattgattgctgaaactggggctggacagcacggggtc
gcaactgcaactattgctgctttgttcgggatggaatgcgacgtctttatgggtaagaaa
gacacgaatcgtcaagcattgaatgtttaccggatgcaactattaggggccaaggtccac
ccggtcacgactggttcaatggtgctaaaggatgcgatcaatgcggccttacaagagtgg
acgcggcgctgtgatgatacagcttatatcatgggctctgcaacgggaccacacccattt
ccaatgatggtacatgaatttcaaagtgtcatcagtgtagaagcccgacagcagatcctg
gaccaaacaggtcatttgccggatgccgtcgtggcttgtgttgggggcggcagtaacgcc
attggaagttttgcggcttttcttgatgatacgtcagttgagctgattggctgtgaggca
gcgggtaagggtgttcaaacgccgttgacggctgcgacgattgaacgtggtcggactggt
atcttccatggcatgaagtcactctttttacaagataaagccggacaaattgccccggtc
tattcaatctcggctgggctggattacccgggcgtcggaccggaacatgcctacctggct
gcgagtggccgggcgcaatatgtggggatcaacgatgaccaagcagtacaagcatttgaa
ctgattgctaaggtcgaaggggtgatctgtgcgattgagagtgcccatgcagtcgcctac
gtacaacaattagcaccaacgatgcgacgtgaccaaactattatttgtacgttatccggt
cgtggagataaagatgtggcggcaattgcaaagtatcgaggggtgacaattgatgactga

DBGET integrated database retrieval system