KEGG   Lactobacillus plantarum WCFS1: lp_1657Help
Entry
lp_1657           CDS       T00115                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00260  Glycine, serine and threonine metabolism
lpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01130  Biosynthesis of antibiotics
lpl01230  Biosynthesis of amino acids
Module
lpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_1657 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp_1657 (trpA)
Enzymes [BR:lpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lp_1657 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1061519
NCBI-ProteinID: YP_004889476
UniProt: Q88WI0
Position
1511223..1512422
Genome map
AA seq 399 aa AA seqDB search
MIKNQSQAGRYGDFGGQYVPETLMTELQRLDRAFQHYRQDAHFQEELTDLLNNYANRPSL
LYHAQRLSDQLGGAQIYFKREDLNHTGAHKINNVLGQALLAKKMGKKRLIAETGAGQHGV
ATATIAALFGMECDVFMGKKDTNRQALNVYRMQLLGAKVHPVTTGSMVLKDAINAALQEW
TRRCDDTAYIMGSATGPHPFPMMVHEFQSVISVEARQQILDQTGHLPDAVVACVGGGSNA
IGSFAAFLDDTSVELIGCEAAGKGVQTPLTAATIERGRTGIFHGMKSLFLQDKAGQIAPV
YSISAGLDYPGVGPEHAYLAASGRAQYVGINDDQAVQAFELIAKVEGVICAIESAHAVAY
VQQLAPTMRRDQTIICTLSGRGDKDVAAIAKYRGVTIDD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatcaatcacaggcggggcgttacggcgactttggtggtcagtacgttcca
gaaacattaatgaccgagctacagcggttggatcgcgcctttcaacattaccgacaggac
gcgcattttcaagaagagttgactgacttgttgaataactatgcgaaccggccatcgttg
ttgtaccatgcacaacgattatcagatcaattaggtggtgctcagatttattttaaacgt
gaggacttgaaccatacgggtgcgcacaagattaacaatgtcttggggcaggcactgttg
gcaaagaagatgggcaaaaagcgattgattgctgaaactggggctggacagcacggggtc
gcaactgcaactattgctgctttgttcgggatggaatgcgacgtctttatgggtaagaaa
gacacgaatcgtcaagcattgaatgtttaccggatgcaactattaggggccaaggtccac
ccggtcacgactggttcaatggtgctaaaggatgcgatcaatgcggccttacaagagtgg
acgcggcgctgtgatgatacagcttatatcatgggctctgcaacgggaccacacccattt
ccaatgatggtacatgaatttcaaagtgtcatcagtgtagaagcccgacagcagatcctg
gaccaaacaggtcatttgccggatgccgtcgtggcttgtgttgggggcggcagtaacgcc
attggaagttttgcggcttttcttgatgatacgtcagttgagctgattggctgtgaggca
gcgggtaagggtgttcaaacgccgttgacggctgcgacgattgaacgtggtcggactggt
atcttccatggcatgaagtcactctttttacaagataaagccggacaaattgccccggtc
tattcaatctcggctgggctggattacccgggcgtcggaccggaacatgcctacctggct
gcgagtggccgggcgcaatatgtggggatcaacgatgaccaagcagtacaagcatttgaa
ctgattgctaaggtcgaaggggtgatctgtgcgattgagagtgcccatgcagtcgcctac
gtacaacaattagcaccaacgatgcgacgtgaccaaactattatttgtacgttatccggt
cgtggagataaagatgtggcggcaattgcaaagtatcgaggggtgacaattgatgactga

DBGET integrated database retrieval system