KEGG   Lactobacillus plantarum WCFS1: lp_1658Help
Entry
lp_1658           CDS       T00115                                 

Gene name
trpB
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp_1658 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_1658 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp_1658 (trpB)
Enzymes [BR:lpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lp_1658 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1512415..1513209
Genome map
AA seq 264 aa AA seqDB search
MTDLTTIFKNHKAFIAFVVAGDPNFEATVDQVVALAEAGCDLVEIGIPFSDPVADGPEIQ
AADLRAFDQHITPQRVFELVVAIREKTTIPLVFLTYANIVYQFGYAAFAQQCQSLNVAGL
IIPDMPLEASGELRPTLDHYGIALIPLIAPTSDDARIAAIAQQARGFIYVVSSLGVTGTR
RHITTDLATLVAKIRHATTLPVAIGFGIHEPAQAQAMAQIADGVIVGSAVVHLIATHQPA
TAVLRDYTRRMRRALDGRTADTVD
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttaacaacaatttttaaaaatcataaggcgtttattgcttttgtagtggcc
ggtgatcctaattttgaagcgacagttgaccaagttgttgcgttagcagaagcgggttgt
gatctcgttgagattggcattccgttctcagaccctgtggctgatggtcccgaaattcag
gccgctgatctccgtgcgtttgaccaacacatcacaccccaacgcgtttttgaattggtg
gtggcaattcgagagaagacaactattccactcgtgtttttaacctatgcgaacattgtt
tatcagtttggttatgctgcctttgcccagcagtgtcaaagtttgaatgtcgcaggcttg
attattcccgacatgccactagaagcctctggtgaacttcgaccaaccttagaccactat
ggtattgctttgattccattgattgcgccaacgagtgatgatgcacgcatcgcagcgatt
gcccagcaggcgcggggcttcatttatgtcgtatcatcactaggtgtcacggggacccgg
cgacacatcacgactgatttagcaacactggtggcgaagattcgccatgcgactacgtta
cctgtcgcaattggttttggtatccatgagccagctcaggcccaggccatggcacaaatt
gcggacggtgtcatcgttggtagtgcagtcgtgcatttgattgcgacgcaccaaccagcg
acagcagtcttaagggactatacgcgacggatgcggcgcgcattggatggtcgcacggct
gatacagttgactga

DBGET integrated database retrieval system