KEGG   Lactobacillus plantarum WCFS1: lp_1658Help
Entry
lp_1658           CDS       T00115                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00260  Glycine, serine and threonine metabolism
lpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01130  Biosynthesis of antibiotics
lpl01230  Biosynthesis of amino acids
Module
lpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_1658 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp_1658 (trpB)
Enzymes [BR:lpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lp_1658 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA DUF561 GcpE UCR_UQCRX_QCR9
Motif
Other DBs
NCBI-GeneID: 1061790
NCBI-ProteinID: YP_004889477
UniProt: Q88WH9
Position
1512415..1513209
Genome map
AA seq 264 aa AA seqDB search
MTDLTTIFKNHKAFIAFVVAGDPNFEATVDQVVALAEAGCDLVEIGIPFSDPVADGPEIQ
AADLRAFDQHITPQRVFELVVAIREKTTIPLVFLTYANIVYQFGYAAFAQQCQSLNVAGL
IIPDMPLEASGELRPTLDHYGIALIPLIAPTSDDARIAAIAQQARGFIYVVSSLGVTGTR
RHITTDLATLVAKIRHATTLPVAIGFGIHEPAQAQAMAQIADGVIVGSAVVHLIATHQPA
TAVLRDYTRRMRRALDGRTADTVD
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttaacaacaatttttaaaaatcataaggcgtttattgcttttgtagtggcc
ggtgatcctaattttgaagcgacagttgaccaagttgttgcgttagcagaagcgggttgt
gatctcgttgagattggcattccgttctcagaccctgtggctgatggtcccgaaattcag
gccgctgatctccgtgcgtttgaccaacacatcacaccccaacgcgtttttgaattggtg
gtggcaattcgagagaagacaactattccactcgtgtttttaacctatgcgaacattgtt
tatcagtttggttatgctgcctttgcccagcagtgtcaaagtttgaatgtcgcaggcttg
attattcccgacatgccactagaagcctctggtgaacttcgaccaaccttagaccactat
ggtattgctttgattccattgattgcgccaacgagtgatgatgcacgcatcgcagcgatt
gcccagcaggcgcggggcttcatttatgtcgtatcatcactaggtgtcacggggacccgg
cgacacatcacgactgatttagcaacactggtggcgaagattcgccatgcgactacgtta
cctgtcgcaattggttttggtatccatgagccagctcaggcccaggccatggcacaaatt
gcggacggtgtcatcgttggtagtgcagtcgtgcatttgattgcgacgcaccaaccagcg
acagcagtcttaagggactatacgcgacggatgcggcgcgcattggatggtcgcacggct
gatacagttgactga

DBGET integrated database retrieval system