KEGG   Lactobacillus plantarum WCFS1: lp_1665Help
Entry
lp_1665           CDS       T00115                                 

Gene name
adh1
Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    lp_1665 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_1665 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    lp_1665 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    lp_1665 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lp_1665 (adh1)
   00626 Naphthalene degradation
    lp_1665 (adh1)
Enzymes [BR:lpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lp_1665 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518456..1519499
Genome map
AA seq 347 aa AA seqDB search
MKSTIFEKAGLVSVQEVDKPTLQSDDDVIVRIVRTCVCGSDLWSYAHGDDKAAHSINEGH
EAIGIVEAIGSAITTVKPGDFVITPFTHGCGECAACLAGFDGTCDRHPGHTNWSNGFQAE
YIRFTYGNWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARCANVQKGDKVVVIGDG
AVGQCAVIAAKLRGAAQIVLMSRHEDRQQMALASGATAVVAERGDEGIAKVREILGGGAD
AALECVGTEAAIDQALGVLHNGGRVGYVGVPHYNNRPLGSTFAQNIAVAGGSASVTTYDK
QFLLKAVLDGNINPGRVFTQTYPLADINQAYQDMQNRKTIKAMITID
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaacaattttcgaaaaagctggactagtatctgttcaggaagttgacaaacca
acattacaatctgatgatgatgtcattgtgcgcatcgtgcggacttgtgtttgtggttcc
gatttgtggtcatatgcgcatggtgatgacaaggctgcccattcgatcaacgaaggacat
gaagctatcggaatcgttgaggcaattggctcggccattacgacggtcaagccaggcgac
tttgtcatcaccccatttacccatggctgtggtgagtgcgcggcttgtttggctggtttc
gatggtacttgtgatcggcatccgggtcacacaaattggtctaatggctttcaagcagaa
tacattcgcttcacttatggtaattgggcgttagttaagattcctggtcaacctagtgac
tatacggaagggatgctcaagtcattgttgacgctggcagacgtgatgccgactggttat
catgcggcacggtgtgcaaacgttcaaaagggcgataaagtcgtggttattggtgacggt
gccgttgggcaatgtgctgtgattgcagctaagttgcggggtgccgcgcaaatcgtcttg
atgagtcgccacgaagatcggcagcaaatggcacttgcttctggcgcgaccgcggttgtt
gctgaacgtggtgacgaaggcattgcgaaggtacgtgaaatccttggtggcggcgcggat
gcggcgttggaatgtgtcggcactgaagcggccattgaccaagctttaggtgttttgcat
aatgggggtcgcgtaggctatgtgggtgtaccacattataataaccggccacttgggtca
acctttgctcaaaatattgcggttgctggtggttccgcctccgttacgacttatgacaaa
cagttcttactcaaagcagttttggacggtaatattaatccgggccgggtatttacgcaa
acgtatccattagccgacattaatcaggcttatcaagacatgcaaaatcgaaagacaatt
aaggctatgattaccattgattaa

DBGET integrated database retrieval system