KEGG   Lactobacillus plantarum WCFS1: lp_1665Help
Entry
lp_1665           CDS       T00115                                 

Gene name
adh1
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    lp_1665 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_1665 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    lp_1665 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    lp_1665 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lp_1665 (adh1)
   00626 Naphthalene degradation
    lp_1665 (adh1)
Enzymes [BR:lpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lp_1665 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518456..1519499
Genome map
AA seq 347 aa AA seqDB search
MKSTIFEKAGLVSVQEVDKPTLQSDDDVIVRIVRTCVCGSDLWSYAHGDDKAAHSINEGH
EAIGIVEAIGSAITTVKPGDFVITPFTHGCGECAACLAGFDGTCDRHPGHTNWSNGFQAE
YIRFTYGNWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARCANVQKGDKVVVIGDG
AVGQCAVIAAKLRGAAQIVLMSRHEDRQQMALASGATAVVAERGDEGIAKVREILGGGAD
AALECVGTEAAIDQALGVLHNGGRVGYVGVPHYNNRPLGSTFAQNIAVAGGSASVTTYDK
QFLLKAVLDGNINPGRVFTQTYPLADINQAYQDMQNRKTIKAMITID
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaacaattttcgaaaaagctggactagtatctgttcaggaagttgacaaacca
acattacaatctgatgatgatgtcattgtgcgcatcgtgcggacttgtgtttgtggttcc
gatttgtggtcatatgcgcatggtgatgacaaggctgcccattcgatcaacgaaggacat
gaagctatcggaatcgttgaggcaattggctcggccattacgacggtcaagccaggcgac
tttgtcatcaccccatttacccatggctgtggtgagtgcgcggcttgtttggctggtttc
gatggtacttgtgatcggcatccgggtcacacaaattggtctaatggctttcaagcagaa
tacattcgcttcacttatggtaattgggcgttagttaagattcctggtcaacctagtgac
tatacggaagggatgctcaagtcattgttgacgctggcagacgtgatgccgactggttat
catgcggcacggtgtgcaaacgttcaaaagggcgataaagtcgtggttattggtgacggt
gccgttgggcaatgtgctgtgattgcagctaagttgcggggtgccgcgcaaatcgtcttg
atgagtcgccacgaagatcggcagcaaatggcacttgcttctggcgcgaccgcggttgtt
gctgaacgtggtgacgaaggcattgcgaaggtacgtgaaatccttggtggcggcgcggat
gcggcgttggaatgtgtcggcactgaagcggccattgaccaagctttaggtgttttgcat
aatgggggtcgcgtaggctatgtgggtgtaccacattataataaccggccacttgggtca
acctttgctcaaaatattgcggttgctggtggttccgcctccgttacgacttatgacaaa
cagttcttactcaaagcagttttggacggtaatattaatccgggccgggtatttacgcaa
acgtatccattagccgacattaatcaggcttatcaagacatgcaaaatcgaaagacaatt
aaggctatgattaccattgattaa

DBGET integrated database retrieval system