KEGG   Lactobacillus plantarum WCFS1: lp_1731Help
Entry
lp_1731           CDS       T00115                                 

Gene name
galM2
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00010  Glycolysis / Gluconeogenesis
lpl00052  Galactose metabolism
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01120  Microbial metabolism in diverse environments
lpl01130  Biosynthesis of antibiotics
Module
lpl_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_1731 (galM2)
   00052 Galactose metabolism
    lp_1731 (galM2)
Enzymes [BR:lpl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     lp_1731 (galM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1063869
NCBI-ProteinID: YP_004889539
UniProt: F9UP86
Position
1568649..1569662
Genome map
AA seq 337 aa AA seqDB search
MRRTISAVPFGVYQGESVYLYTIENIHHSKLKVLSYAATWYDFEVQVDRQPQSLVLHFDN
LADYIETPYQVGKTVGRVAGRIGNATFSLNGQTYHLPPNNGRHLLHGGGHGLQTHNFRAR
FDPDGDTVILTTTLASADDGFPGDLTVTISYTLTADDEVQISYHGVTTADTLFNPTCHVY
FNLDGQAALINPQQLRINSTKLVHTNHEKVPTGVFYVPSPAYDFREQPTIQSQLDRLIQE
TGRTEYDDCYVLDHQDEPAGVLATTHGRLLINTDRNGLVIFTANPERTQPYRLGDYHALA
VELQTLPDAINHHGFGDVVLRAGQPRTYVNRYQYVSK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtacgatttctgcagtaccatttggtgtgtatcaaggcgagtcagtctattta
tacacgattgaaaatatccatcatagcaaactaaaagtgttgagttatgcggcaacgtgg
tatgacttcgaagtgcaggtcgaccgccagccacaatcattagtgcttcactttgataac
ttggcggattatatcgagacgccttatcaagtcggcaaaacagtgggtcgagttgctggc
cgaatcggtaacgcgacgttttccttgaatgggcagacataccacttaccgccaaataac
ggccggcatttgctacacggtggcggtcatggcttacaaacgcataattttcgagcccgt
tttgatcctgatggcgacactgtcatattgacgacaacgctagcgagcgctgacgatggg
tttccaggcgacttgacagtaactataagctatacgttaacggccgatgatgaggttcaa
atcagctatcacggggtgaccactgctgatacgttattcaatccgacctgtcacgtttac
tttaatcttgatggtcaggccgcactgattaatccccagcaattacgtatcaactcgacc
aagctagttcatacgaatcacgagaaggttccgaccggcgtcttctacgtcccgtcacca
gcgtatgactttcgtgagcagccaacgattcaatcgcagctcgatcgattgatccaagaa
actggcaggacggaatacgatgattgctatgtgcttgaccaccaggatgaacccgctggc
gtgttggcaacgactcacgggcgactgctcatcaacacggatcgcaatggtttagttatc
tttaccgctaatcccgaacgaacgcagccgtatcgtttaggggactaccatgcgctggcc
gtagaattgcaaaccttgccggatgctattaatcatcatggctttggcgatgttgttcta
cgggctggtcagccacggacgtacgtgaaccgctaccaatacgtgtcaaaatag

DBGET integrated database retrieval system