KEGG   Lactobacillus plantarum WCFS1: lp_1869Help
Entry
lp_1869           CDS       T00115                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lpl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lpl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688875..1689366)
Genome map
AA seq 163 aa AA seqDB search
MIALIWAEDQNGLIGNQGQLPWHLPADMQRFKALTTGHHVVMGRKTFAGFKRPLPRRTNW
VLSRQSDLKLPPEVHQLADVAAIQTLAAAHPDEPIFVIGGAVVFEAVLPVADYLYRTRIN
ARFDGDTWMPAVDYTQWQLVSQQIGTVDEKNQYPYEFDDFRRR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgattgcattgatatgggcagaagatcaaaatggcctgattggcaaccagggccagctt
ccctggcatttaccagcagacatgcagcggttcaaagcgctgacgaccggacaccatgtc
gtgatggggcgcaagacttttgcgggctttaaacgcccgctcccacggcggaccaattgg
gtgctctcacgtcagtctgatttaaagttgccaccggaagtccatcaactagcagatgtg
gcggcgatccaaacactcgcggccgcccatccggatgaaccgatttttgtcattggtggt
gcggtggtgtttgaagccgtgttaccggtggccgattatttatatcggacgcgtatcaac
gcaaggtttgatggtgatacttggatgccggccgtggattacacgcagtggcagctggtg
agccaacaaattgggacggtggatgagaaaaatcaatatccgtacgaatttgatgatttc
cgccgtcgttaa

DBGET integrated database retrieval system