KEGG   Lactobacillus plantarum WCFS1: lp_1869Help
Entry
lp_1869           CDS       T00115                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lp_1869 (dfrA)
   00670 One carbon pool by folate
    lp_1869 (dfrA)
Enzymes [BR:lpl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     lp_1869 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688875..1689366)
Genome map
AA seq 163 aa AA seqDB search
MIALIWAEDQNGLIGNQGQLPWHLPADMQRFKALTTGHHVVMGRKTFAGFKRPLPRRTNW
VLSRQSDLKLPPEVHQLADVAAIQTLAAAHPDEPIFVIGGAVVFEAVLPVADYLYRTRIN
ARFDGDTWMPAVDYTQWQLVSQQIGTVDEKNQYPYEFDDFRRR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgattgcattgatatgggcagaagatcaaaatggcctgattggcaaccagggccagctt
ccctggcatttaccagcagacatgcagcggttcaaagcgctgacgaccggacaccatgtc
gtgatggggcgcaagacttttgcgggctttaaacgcccgctcccacggcggaccaattgg
gtgctctcacgtcagtctgatttaaagttgccaccggaagtccatcaactagcagatgtg
gcggcgatccaaacactcgcggccgcccatccggatgaaccgatttttgtcattggtggt
gcggtggtgtttgaagccgtgttaccggtggccgattatttatatcggacgcgtatcaac
gcaaggtttgatggtgatacttggatgccggccgtggattacacgcagtggcagctggtg
agccaacaaattgggacggtggatgagaaaaatcaatatccgtacgaatttgatgatttc
cgccgtcgttaa

DBGET integrated database retrieval system