KEGG   Lactobacillus plantarum WCFS1: lp_2168Help
Entry
lp_2168           CDS       T00115                                 

Gene name
recD
Definition
exodeoxyribonuclease V, alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lpl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1957656..1960205)
Genome map
AA seq 849 aa AA seqDB search
MTDEQAHLFSDDIGREPVTHFIVGKVAAVFFSSADSFYKVLLVKVTEQNIDWSEDEIVVT
GNFADIQEETTYRFTGKTVTHPKYGVQFQADNYQNETPTTRAGLIAYLSGSDFPGLGKRT
AERIVDTLGEDAIDQILADPKVLKPIGLRASVQTTLIDTLTVNNGLEQTIIGLNAYGFGS
RLAAAIYARYQGDTLAKIQANPYCLVEDIKGVGFKKADQIAAQLKIDPQADDRLKAALLT
EINELCVENGDTYTTAQPLLNQTLQLLENARNVQIDPSKLADQLVVLAKENKIVGDENRI
YLRGLYEAEWRVAEHLQRLLAADNDEKLSERAVDHAIEHVGRASNITYDESQTEALKAAI
TAPVFLLTGGPGTGKTTIIRGLVALYAELHDVALDINQYKDKPFPILLAAPTGRAAKRMA
ETTGLPASTIHRLLGLTGREDGPEEPSKELDGGLLIIDEMSMVDTVLFQQLLTAIPSHMQ
VILVGDKDQLPSVGAGQVFHDLLQFSELPQIELTTIYRQGNDSSIIPLAHAIKDGHLPAD
FAVNQPDRSFIACNAYQVNHIVEQVVARAKAKGFSAEEVQILAPMYRGTAGIDQLNTTVQ
KIFNPLKSAHQKHLTYNGQDFRVGDKVLHLVNSPEDNVFNGDIGKIVGIDLANDSHNESK
KDQITIAFDQNEVTYQRNEWNRLTLAYSMSIHKSQGSQFKMVILPLVPQFARMLQRNLLY
TAVTRAEQMLILLGDSQSFERSVTNESVNRQTTLTKRLQQVFGGDTVSDETATIATTDQA
EAMPAGEKATAVKKVASDEESATEKPQEPSSQSAGPTILTPALVSAGRIDPMIGMNGITP
ANFMPQVAN
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacgaacaagcacatttattttccgacgatattggtcgggaaccggtcacacac
tttatcgtcggtaaagtcgctgccgttttttttagcagtgccgatagtttttataaagtc
ttattagtcaaagtaactgaacagaacattgattggtcggaagatgagatcgttgttact
ggaaattttgcggatattcaggaggagacaacgtatcgttttaccggtaaaacggtcacg
catcccaaatacggggttcagtttcaagcggataattatcaaaatgaaacgcccacgaca
cgcgcaggcttgattgcctatctatctggtagtgattttcctgggttgggtaagcggact
gctgagcgaatcgtcgatactttgggcgaagacgccattgatcaaattttagctgatccg
aaggttttaaaaccaatcggacttcgggccagcgttcagacgactttgatcgacacgctc
acggtcaataacggtttggagcaaactatcatcggacttaatgcgtacggttttgggagt
cggttagctgcggccatctatgcacgctatcaaggtgacactttggctaagattcaagcg
aatccgtactgtttggttgaggatatcaaaggcgtcgggttcaaaaaagcggatcaaatt
gcggcccaacttaaaattgatccccaagcggatgaccggttaaaggcggccctattgact
gagattaatgagctgtgcgtggaaaacggtgatacgtataccacggctcaaccgttgctg
aatcaaacgttgcaactacttgagaatgctcgcaatgttcaaattgatccttcgaagctg
gctgatcagttggtcgtcttggcgaaggaaaataaaatcgtgggtgacgagaatcgtatc
tacttgcgcggcctctatgaagccgagtggcgcgttgcggaacatttacaacggttgtta
gccgccgataatgatgaaaaattgtctgaacgtgccgtggatcatgctatcgagcatgtc
ggtcgagctagcaacattacttatgatgaatcacaaaccgaagcactaaaagcggcgatt
acggcgcctgtttttctactaactgggggaccggggactggtaaaacgaccattatccgt
ggcttagtcgcgctctatgcggaattacacgacgttgcactagatatcaatcagtataag
gataagccttttccaatcctgctggcggcaccgactggacgggcagccaagcggatggct
gaaacgactgggctcccagctagtactattcatcggttgcttgggttgacggggcgtgaa
gatggtcccgaggagcctagtaaggaattagatgggggcctcctgattattgacgaaatg
tcgatggttgacacggtactgtttcagcagttactgacggcgattccaagtcacatgcaa
gtcattcttgttggcgataaggatcaactgccatcggtaggagccgggcaagtgtttcat
gatttattgcagtttagtgaactgccccaaattgagttaacgacaatctaccggcagggc
aatgattccagtattattccgttggcccacgccatcaaagatggtcatttaccggccgat
tttgccgtcaaccaaccggatcgctcatttattgcctgcaacgcttatcaagtcaatcac
attgttgaacaagttgtggcacgtgccaaggcgaagggcttcagtgctgaggaggtacaa
attctggccccgatgtatcgcggcactgccgggatcgatcagctgaataccacggttcag
aaaatctttaatccgttgaagagtgcccatcagaagcatctaacgtataacggtcaagat
tttcgggtcggtgataaggtcctgcacctcgttaattcacccgaggataatgtttttaat
ggcgacattggtaaaatcgtcggtatcgatctggcaaatgattctcacaatgaatcgaag
aaagaccagatcacgattgcctttgatcaaaatgaagtgacttatcaacgcaatgaatgg
aatcgattgacattagcgtacagtatgtcgatccacaagtctcaagggagccagtttaaa
atggtgattctgccactggtaccacaatttgcacggatgctacaacgcaatctactgtat
actgccgtgacacgtgctgaacaaatgctgatcctgttaggtgatagtcaatcatttgag
cggagcgttaccaatgaatcggttaatcgccaaaccacactgacgaaacggttacaacaa
gtctttggcggggataccgtatccgatgaaacggccactattgcgactactgaccaagca
gaggcaatgccagccggcgaaaaagcgacggcggttaagaaagttgcttctgacgaggag
tcggccactgaaaaacctcaggaaccgagttcccagtctgctggaccaacaattttgacc
ccagcgctagtcagcgctggccgaatcgatccgatgattggcatgaatggtatcacgcca
gctaatttcatgccgcaagtagctaattga

DBGET integrated database retrieval system