KEGG   Lactobacillus plantarum WCFS1: lp_2645Help
Entry
lp_2645           CDS       T00115                                 

Gene name
acm2
Definition
cell wall hydrolase/muramidase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     lp_2645 (acm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2352090..2354447)
Genome map
AA seq 785 aa AA seqDB search
MKIGMTKKVVTSLLLSTALLPMLSGKADTASANQKPAAATKGNSAASAASQQVTLSAGSQ
TETTAAGATDQSVASDGAKTDDQAESTSTTTATTSATSRVTVRAASQAAKADSTGPQSQS
SASEAAKDNAATSATADSTTSAVDQLDKTAKASAATSQASHSTTNETAKASAAASQDSHV
TTDQSSVTVTSEVAKSAASSAAPKQATEQAVAAKISPKIETAVAADAVQSSAMMARSTRA
MTSQEIFLSQIKAGAISGWNKYQVLPSVTAAQAILESGWGQSQLATQGNNLFGIKGSYQG
QSIYFPTQEWNGSQYITIQDAFRKYPNWSASVEDHGAFLVVNPRYSNLIGVTDYRRVASL
LQQDGYATAPTYASSLISIIEYNKLHEWDQEALSGQASGGNDNNQVQPDQDVTPTSGTHK
FTKTTTIHNAPDATSAVVGTYNAGETVNYNGKLTVGNATWLRYQSYSGVSRYVMISQTTT
NDNNNQATVTPASGSYKFTAKTNIRSAASKTAQVVGTYNAGETVYYNGKITTGGTTWLRY
LSYSGAQHYVAMSGDEVGSVAKPDVVATSGSYRFTKTTAIKSSPATSATTVGSYNAGDTV
YYNGKVTTNGQTWLRYMSYSGAQHYVQISGESTSTNVDKPQVTPQSGSYRFTQTTAIKNT
PAGNAPSVGTYSAGDTVYYNAKVTANGQTWLRYLSYSGAQHYVAISGNAATGNTTSKPVT
NSQGAFRFVTTTNIRTAPSTRASVVGEYNPGETVYYNGTVQAEGYTWLRYLSRSGATHYV
AKLEG
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattggaatgacaaaaaaagtagtaacttcattattgctaagtaccgctttgctg
ccgatgttgagtggtaaagctgatacggcaagtgcaaatcaaaaaccggcagctgcgact
aagggaaacagcgctgcttcagctgcaagccaacaagtgaccttaagtgctggcagtcag
acggaaacgacagcggccggtgcgactgaccaatcagttgccagtgacggtgccaagact
gacgatcaagctgaatcgaccagcacgacgacggctactaccagtgcgacaagtcgtgtc
acagtgcgggcagccagtcaagccgctaaagctgacagtacaggaccgcaaagccagtcc
tccgccagtgaagctgccaaggataacgcggctactagtgctacggcggactccacaact
agtgctgttgatcaacttgataaaacggccaaagctagtgcagccacgagccaagccagt
cacagtacgactaatgagacggctaaagccagcgcggccgcaagtcaggatagtcatgtc
actacggaccaatccagcgtgactgtgacgagtgaagtagccaaatcagccgcatcgtca
gccgcacctaagcaagcgactgagcaggcggtagccgcgaaaatctcaccaaagattgag
acggctgtggcggctgatgcggtccagtcatcagcgatgatggcacggtccacgcgggca
atgactagtcaggaaatcttcctgagtcagattaaagcgggggcaatctctggttggaac
aagtatcaagtcttgccatcagtcacggccgcacaggcaattctggaaagtggttgggga
caatcacaacttgcaactcagggaaacaacttattcggtatcaagggaagttatcaaggg
caatcaatctacttcccaacccaggaatggaatggctcacaatacattacgattcaagac
gcttttcggaagtacccgaattggtcagctagtgttgaagatcatggcgcctttttggtt
gtcaatccgcgttacagcaatttaattggggttaccgattatcggcgcgttgccagtctc
ttgcaacaagacggctacgcaaccgcgcccacgtacgcgagttcgctgatcagcatcatt
gaatataacaagctacacgagtgggatcaagaagcgctcagtggtcaggcaagtggcgga
aatgataataaccaagttcagcctgatcaagacgtcactccaaccagtggtacacataag
tttactaagacaacgacaattcacaatgcgccggacgccacgagtgccgtagtgggtact
tacaacgctggtgaaacagtcaattacaatggtaagttaacggtcggtaatgcaacttgg
ttacgctatcagtcctattctggcgtatcacggtatgtgatgattagtcaaacaacaact
aatgataataataaccaggcgacagttacgccagctagtgggtcgtataagtttaccgca
aagaccaacattcgatcagctgcaagcaaaacggctcaagtggtcggcacttataatgct
ggtgagacggtttactataatggcaagattaccacgggtgggacaacttggttacggtat
ttatcctattcaggcgctcagcattacgtggctatgagtggtgatgaggttggttctgtg
gctaaaccggacgtggttgcaaccagtgggtcgtatcgtttcacgaaaacgacagcaatc
aagagttcacctgcaactagtgcgacaacggttgggtcttataatgctggcgatacggtc
tattacaatggtaaggtgacgacaaatggtcagacttggttacgttacatgtcttactca
ggtgcccagcattatgtgcaaattagtggtgagagtacgtcgaccaatgttgataaaccg
caagtaacgcctcaaagtggtagttatcgctttacgcaaacaacggcgattaagaataca
ccggccggaaatgccccaagtgtcggtacctatagtgctggtgatacagtctactacaac
gctaaggtaacggctaacggccagacttggttacggtatttgtcttattcgggcgcccaa
cattacgtagcgattagtggtaatgccgctaccggaaatacgacgtctaagccggtaaca
aacagtcaaggggcgttccgcttcgtaacgacgactaatattcgtacggcgccaagtacg
cgcgcaagcgttgtcggtgaatataacccaggtgaaacggtttattacaatgggacggtt
caagctgagggttacacgtggctccgatatctgagtcgctccggtgcaacgcactatgtt
gctaagcttgaaggctag

DBGET integrated database retrieval system