KEGG   Lactobacillus plantarum WCFS1: lp_2758Help
Entry
lp_2758           CDS       T00115                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp_2758 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_2758 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lp_2758 (thrC)
Enzymes [BR:lpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lp_2758 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2451373..2452866
Genome map
AA seq 497 aa AA seqDB search
MKTLYRSTRETASHTMTSSQAVLQGLTPDGGLFVPVTLPTANFDFDQLATMSYQEVAYEV
LKLFFTDYTADELHACIDAAYGDQFDDPQIAPVTKHGQQYYLELFHGPTIAFKDLALQIL
PHLMTTAVKKNHLQAEVVILAATSGDTGKAAMAGFANVDQTRIIVFYPKDGVSAIQKQQM
VTQTGANTSVVAINGNFDEAQTTVKKLLNDHQLHAELATHQFQFSSANSINIGRLFPQVA
YYVYTYAQLIKQGQIKNGDEINFSVPTGNFGDILAGYYAKQLGTPIHKLICASNRNNVLT
DFFNTGTYDKNREFFLTSSPSMDILVSSNLERLLFYLTGSDATATAKLMTDLQTTGRYTI
TPAMRANLADFWAGFVTESQDQAEIHHLNHAHHYTIDPHTAVASAVAKQYQAATRDQRPM
VVVSTASPYKFPQAVLTAITGELSAVDGLAAVDQLHELIQTPIPATVTALRTAPVRHKRV
ADVDDMGTTIKTILNLN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactttatcgcagtacccgcgaaactgcaagtcacaccatgacgtcatcacaa
gccgtacttcaaggcctgacgccggatggtggtctctttgtgcccgtaacgctaccgacc
gctaattttgacttcgaccagctcgccacgatgagctaccaagaagttgcttacgaggtc
cttaaactcttcttcacggattataccgctgatgaattacacgcctgcattgacgcggct
tatggtgatcagtttgatgacccccaaattgcgccggtcaccaagcatggtcagcagtat
taccttgaactttttcatggaccgaccattgcattcaaagacttggcccttcaaatccta
ccgcatttgatgacaacggcagttaaaaagaaccatttacaagccgaagtcgttatttta
gcggccacctctggcgatactggtaaagctgccatggccgggtttgccaatgttgatcag
actcgcatcatcgtcttctatccaaaagatggtgtcagcgcaatccaaaaacagcagatg
gtgacccaaaccggagccaatactagtgttgttgcgatcaacggtaacttcgatgaggcc
caaacaacggttaaaaaactgttaaacgaccaccaattacacgcggaattagccacccac
cagttccaattctcaagcgctaattccatcaatattggtcgtttattcccacaagtggcc
tattatgtctacacctacgctcaacttatcaagcaggggcaaatcaagaacggtgatgag
attaactttagtgttccaactgggaactttggggatattttagctggctactatgccaaa
caactgggcacgcccattcataaactgatctgtgcttccaatcgcaataacgttctcacc
gatttctttaataccgggacttatgataaaaaccgtgaattcttcttgacgagttcaccg
tccatggacatcttagtctcaagtaacttggaacggctcctcttctacttgacaggatca
gacgccacggcgactgctaaactaatgactgatttgcaaacgaccggccgttatacgatt
acaccggcaatgcgtgccaacttagctgatttttgggccggcttcgtgactgaaagccaa
gatcaagctgaaattcatcacctgaaccatgcccatcactacacaatcgatccacatacg
gccgtggcctcggcggttgccaaacagtatcaagccgcaaccagagatcagcggcccatg
gtggttgtttcaaccgctagtccgtataaattcccacaggccgtcctaacggcaattact
ggtgagcttagtgcggtagatggcctagccgcagttgatcagttacatgagttgattcaa
acgcccattccagcaacggtcacagccctccgtactgcgcccgtgcgccataagcgggtt
gcggatgttgatgatatgggaacgaccattaaaacaattttaaatcttaactag

DBGET integrated database retrieval system