KEGG   Lactobacillus plantarum WCFS1: lp_2868Help
Entry
lp_2868           CDS       T00115                                 

Gene name
pgm8
Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lp_2868 (pgm8)
   01230 Biosynthesis of amino acids
    lp_2868 (pgm8)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_2868 (pgm8)
  Energy metabolism
   00680 Methane metabolism
    lp_2868 (pgm8)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_2868 (pgm8)
Enzymes [BR:lpl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     lp_2868 (pgm8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2554944..2555582)
Genome map
AA seq 212 aa AA seqDB search
MKSITLHLVVAGATYFNQLDRFQGWSGTPLTATGEQATAKVAQQLASTTFDTAFASDTSR
AIQTARIILDSRAQPVKLRTVVALRAPFYGGFEGTERAAVWSGFATKLGYQSVAAFAADQ
TPSELQTLLHDHDADGLAESGQEFWDRYQKGLQQVMAATPDHGQVLLIVDGATLRMMHYV
ATGRAATRQELAPSVVTTMVYTGDKLTVPVTE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaatcaccttacacttagtcgttgctggagcaacgtactttaatcaacttgac
cggttccagggttggagcggcacgccgttgacggcgactggcgaacaggcgacggccaag
gttgcgcagcagttggcgtcgacaacgtttgataccgccttcgctagtgatacgagtcgg
gcgattcagactgcgcgcattatcttagactcacgagcacaacccgttaagttgcgaacg
gtagtcgcgttacgtgcgccattctatggcggctttgaaggcactgaacgcgcggcggtt
tggtcaggatttgcgactaagctaggttatcagagtgtggccgcttttgccgcagatcag
acccccagtgagctacagacattgttgcacgatcacgatgcggatggattggcggaaagt
gggcaggagttctgggatcgctatcaaaaggggttacaacaggttatggcggcaacgcct
gatcatggtcaggtcttgttgattgtggacggcgcaacgttgcgaatgatgcattacgtc
gcaactggtcgtgcggcaacgagacaggaattggcaccaagtgtggtgacaacgatggtt
tacactggggataagttgactgtaccggtcacggaataa

DBGET integrated database retrieval system