KEGG   Lactobacillus plantarum WCFS1: lp_2868Help
Entry
lp_2868           CDS       T00115                                 

Gene name
pgm8
Definition
(RefSeq) phosphoglycerate mutase family protein
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2554944..2555582)
Genome map
AA seq 212 aa AA seqDB search
MKSITLHLVVAGATYFNQLDRFQGWSGTPLTATGEQATAKVAQQLASTTFDTAFASDTSR
AIQTARIILDSRAQPVKLRTVVALRAPFYGGFEGTERAAVWSGFATKLGYQSVAAFAADQ
TPSELQTLLHDHDADGLAESGQEFWDRYQKGLQQVMAATPDHGQVLLIVDGATLRMMHYV
ATGRAATRQELAPSVVTTMVYTGDKLTVPVTE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaatcaccttacacttagtcgttgctggagcaacgtactttaatcaacttgac
cggttccagggttggagcggcacgccgttgacggcgactggcgaacaggcgacggccaag
gttgcgcagcagttggcgtcgacaacgtttgataccgccttcgctagtgatacgagtcgg
gcgattcagactgcgcgcattatcttagactcacgagcacaacccgttaagttgcgaacg
gtagtcgcgttacgtgcgccattctatggcggctttgaaggcactgaacgcgcggcggtt
tggtcaggatttgcgactaagctaggttatcagagtgtggccgcttttgccgcagatcag
acccccagtgagctacagacattgttgcacgatcacgatgcggatggattggcggaaagt
gggcaggagttctgggatcgctatcaaaaggggttacaacaggttatggcggcaacgcct
gatcatggtcaggtcttgttgattgtggacggcgcaacgttgcgaatgatgcattacgtc
gcaactggtcgtgcggcaacgagacaggaattggcaccaagtgtggtgacaacgatggtt
tacactggggataagttgactgtaccggtcacggaataa

DBGET integrated database retrieval system