KEGG   Lactobacillus plantarum WCFS1: lp_3011Help
Entry
lp_3011           CDS       T00115                                 

Gene name
pbg6
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lpl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2678548..2679930)
Genome map
AA seq 460 aa AA seqDB search
MDKERQMPKDFFWGNSVSSMQTEGAWDEDGKGRSVYDVRPATATTSDWHDAIDEYHRYEE
DLDLMKDLHLNMYRIQISWSRVVPDGDGEFNAAGIAFYDRLVDAMLARGITPMICLYHFD
MPLALAENENGFMSRHTVDAFVRFGEKMIAHFADRVKYWIVFNEHNLYFTDEVFNISGYT
KGDQSVNDLYRIFHHTMLAHARLDDFVHQNYDDVKIGGMLAYTPVYPETAKPIDIMAARK
SDEFLNNNLNDAYVHGHYSPEVLRYVEQQGIDYDLQPGDEAIIGKMKADFLAFSYYRSTV
INGDKIPVNAVPNRYLNYSFEANRFLQANEWGWAIDPLGFRNLITKLYDQYEVPVFPIEN
GIGLREHWDGQHMIEDDERITYHEEHIKAMKDAMLIDGAKVLGYLGWGLIDIPSSHADIE
KRYGVVYVNRSNHDLKDLKRVPKKSYYWLQGVLAKNGDEL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggataaggagcgacagatgcccaaggattttttctggggtaattcagtgtcaagtatg
caaactgagggtgcttgggatgaagacggtaagggccgttcagtttatgatgttcgtcct
gcgacagcaaccacttcggattggcatgatgccattgatgaatatcatcgttacgaggaa
gatcttgatttgatgaaggacttacatttgaatatgtatcgaattcagatttcatggtca
cgagtagttccagatggtgatggtgagtttaatgccgctgggattgcgttttatgatcgg
ctggttgatgcgatgctggcacgggggattacaccgatgatttgcctgtatcactttgat
atgccgttagccttagctgaaaatgaaaacgggttcatgtcgcgccacaccgttgatgcg
ttcgtccgttttggtgaaaagatgattgcccattttgctgaccgggttaaatattggatc
gtgttcaatgaacataatttatactttaccgacgaagtcttcaacatttcagggtacacc
aagggtgatcaaagtgttaacgacttataccggattttccaccatactatgttagcgcac
gcgcgcctagatgactttgttcatcagaactacgatgacgtgaagattggtggtatgtta
gcttacaccccggtttatccagaaacagctaagccaattgatattatggcggctcgtaag
agtgacgaatttttgaacaacaacttgaatgacgcttacgtgcacgggcactattcacca
gaagtcctgcgttacgttgaacaacagggcatcgattatgatttgcaaccaggtgatgaa
gcaatcattggcaaaatgaaagcggattttttggcctttagttattatcgttcaacggtt
atcaacggggataaaatacccgttaatgccgttccgaatcgttatctcaattattctttt
gaggccaaccgttttttacaagctaatgaatggggctgggcgattgatccactcggtttc
cgcaacttgattaccaagttgtatgaccagtacgaagtacccgtgttcccgattgaaaat
gggattgggttacgcgagcactgggatggccagcatatgatcgaagatgatgagcggatt
acttatcatgaagaacatatcaaggcgatgaaagatgccatgttgatcgacggcgctaag
gtactaggttatctcggctggggcttgattgatattccaagttcacacgcagatatcgaa
aaacgttacggagttgtttacgttaaccggagtaatcatgatctaaaagacttaaagcgg
gttcccaagaagtcatattattggctgcaaggggtcctagcaaaaaatggagatgaattg
taa

DBGET integrated database retrieval system