KEGG   Lactobacillus plantarum WCFS1: lp_3093Help
Entry
lp_3093           CDS       T00115                                 

Definition
lysozyme/muramidase, glycoside hydrolase family 25
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2753017..2755599)
Genome map
AA seq 860 aa AA seqDB search
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNDTNVHADATNATTTSSS
AASTASSASVATSSAASDETTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTS
TASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVK
AVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQST
MTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAA
KSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTS
NSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDV
SIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNT
AIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKP
AASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRY
LSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLG
TYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQ
SGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKV
SGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADG
YQWLKYLSNSGAYHYVAKIG
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaaatcacaaaatccaattgatgcaagtcagtcggaaagattcaagctttat
aagtcggggaaactttggctggttgctggattaactttcttctcatttttaggaggttcc
gttcttaacgatacaaacgtgcacgctgatgctacaaatgcaacgacaacatcgtcttca
gctgcaagcacggcctctagtgcaagtgttgcaacgagctctgctgctagcgatgagacg
actaaagcgacctcagtttcgtcaagtgctgcgactcaagtaacgagtgcggcaacaact
aagacgaccagtcaagcagcgacggcatcgtcgagtgcggccactagccaatcgaccagt
acagcatctagctcgactagtcaagcaactaagacggcttcgagtgcagccactagtact
tctgcaacggctacaagccaagcaaccagtgtcgcttctagtacggcaaccactactcaa
gtaagtcataccgcaagcagtactgctgccagtgctgcttcaagtactgcaacggtcaag
gctgttaaggccgcttcaagtacggtaagtagtgcggcgacgaccgctactaaagccaca
gctaaagttgctgccgttgcttataccgcagcaacgacgtcttcaacggatgtctggacg
attggggatacgactcggccacgcgttgatgttgttgacgtggcgtcatatcaaagtacc
atgacgcaatctgatttcaataagttaaaggctgcgggtgttaagacggtcatcgttaag
tcgactgaaggcactgattacacgaacccagctgcactgaaccaagcaaagatggctaac
aaagctggcttgaacgttgatttctaccactatgcaacgtttagcacggctgatgcggct
aaatctgaagcgactaacatggctggtttcttagttaagaacaatgtttcaaccaaagtt
ctcttgttcgctgacatggaagattcatcttcatactcagttaacgcaacggcgaacttg
aacgcgttctggtcaacgttagattcctttggttacaagaatcacggcgtttatacgtcc
aactcatacttatatcgggatgctgttgttaagacagttggccaatcacgtgtatggcgg
gcccaatacccatacacgccttctgctaataacctttggaacaccaatgatggtgcatgg
caattctccgatacggcactcttaccatctggttcagattataccggttacattgatgtc
agcatcgattacaatggtttaactgaagatagtgccgggaccaatacattcgtaacgaca
actagtagcaatgatacgacgactagtgaagtaacgactgacactagtgctacgaccaat
acgtcaactagttcaacgactaagaaggcctctggttggtatacctttaccaagaacaca
gccatcaagagcgctgccagtgacagtgctaaaaccgttggaacttatagcaagggtaac
cgcgtttactataatgctgaaattacaactaatggtgaaacttggttacgttacttaagt
tacagtggtagcgaacattttgttaagattgccgcagctaaaacgaccacgactaagcca
gccgcaagcactagcaagacggttaccaagaatgaaactggcacttacaagtttactaaa
acgacagctatcaagggttcagttagtgactcagctaagactttagggacttactacaaa
ggtgacacggtttattacaatgccaaggttactaagaatggtgaaacttggctccgttac
ctgagttacagtggtgcgcaacactacgttaagatcagtggtgcagctacgtcaacgact
accaccaagccagccactagttctagcaagacggtcactaaggctgaaactgggacttac
aagtttactggcaccacggccatcaagggttcagttaatgattcagccaagactttaggg
acttactacaagggtgatacggtttattacaacgccaaagtcactaagaacggccaaact
tggcttcgttacttgagttacagtggtgcgcaacactacgttaagattagtggtgcagcc
acaacaacgacgacgtcaagcaagtcaacggctacggctagtgctaagacagttgcgcaa
agcgggacttacaagtttgctaagacgactgccatcaagtcttcagcaagtgatgccgct
tcaactgttgggacttactacaaaggcaatacggtcaactacaacgccaaagtaacgact
aacggtcaaacttggttacgttacacgagttacagtggtgcgcaacactacgttaaggtc
agtggcggtgccgcaacgaccacgtcatcttcagcaagtaagacgacggcggctgctggt
acgtacacatttaagaccacaacgaatattcggaccgctgctagtctaaatgcctcagtt
gttggccaatactccgcgggcgaatccgtttattatattggaacggtttctgcggatggc
tatcaatggctgaagtacttatctaactctggtgcttaccattacgttgctaagattggc
taa

DBGET integrated database retrieval system