KEGG   Lactobacillus plantarum WCFS1: lp_3132Help
Entry
lp_3132           CDS       T00115                                 

Gene name
pbg7
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_3132 (pbg7)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     lp_3132 (pbg7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2799769..2801220)
Genome map
AA seq 483 aa AA seqDB search
MGLRKDFLWGGAIAANQVEGAWNIDGKGLSVADVATYKPNVDVKDYRKQVGVTKSDIEKA
IQDTDTKYYPKRRGIDFYHRYPEDLELFHEMGFKALRLSIAWTRIFPTGEEFEPNQAGLD
YYKAMFNKMHELGIEPIVTLSHYEMPLALASKYNGWENRKVIDLFVRFCKVCFETYKNDV
KYWLTFNEIDSVTRHPFTSAGIIPDQTDNLLQAEYQAFHHQFVASALVTKSCHEVIPGSQ
VGCMLTKLTDYPNSSDPRDVLASFNKNTMNYFPADVQVFGEYPPLVLNYFKKQKIHIDMT
ASDLEILKENTVDFVTFSYYMSLVSSYDENNLTLTTGNTIVGGKNPHLPVTEWGWTVDPV
GLRISLLQLYDRYHKPLMIVENGMGAKDELTADQKIHDDYRIKYFRAHFNEMIKAVDAGV
DLLGYTSWAPIDLVSASTSQMSKRYGFIYVDEDDLGNGSLKRYRKDSFTWYQKVIQTNGT
SLD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggattacgaaaagatttcttatggggtggcgcgatagctgccaatcaagtagaaggt
gcatggaatatcgatggaaaagggttatcagttgcggatgttgcgacgtataagcccaat
gtggatgttaaagattatcgcaaacaggttggtgttacaaagtctgatattgagaaagca
atccaagatacagatactaagtactatcctaaacgacgtggtattgatttttatcaccgt
taccccgaagacttggaattatttcatgaaatgggatttaaagcattgcgtttatccatt
gcctggacacggatatttccaacaggtgaggaatttgagcccaaccaagctggtttagac
tactataaagcaatgtttaataagatgcatgagttaggaattgaaccaattgtgacatta
tcacattatgaaatgccacttgcattagcgtctaaatataatggttgggaaaatcgcaaa
gtcattgatttatttgttcgtttttgtaaagtttgttttgaaacttacaagaatgatgtt
aaatattggctgacattcaatgaaattgatagcgttacgcgtcatccatttacttcagcc
ggtattattcctgatcagactgataatttgttacaagcagagtatcaggcattccatcat
caattcgtggcgtctgcgctggtaacaaaatcttgtcacgaagttatccctggtagtcag
gtgggatgtatgctaacaaaattgacagattacccgaattcatctgatccgcgtgatgtg
ttagcatcattcaataaaaatacaatgaattattttccagcagatgttcaagtatttggt
gaatatccacccctagtattgaactacttcaaaaaacagaaaattcacattgatatgact
gcatcagacctggaaattttgaaggaaaatactgtagactttgtaacgtttagttactat
atgtcactagtatcatcatatgatgaaaataatttgacgttgacgactggtaatacgatt
gttggtggtaagaatccacatttgccggttacggaatggggatggacagttgatccggtt
ggcttaagaatttcgttgttacagttatatgatcgctatcacaagccgttaatgattgtt
gaaaacggaatgggtgctaaagacgaattaacagcggatcagaaaattcatgatgactat
cgcatcaaatatttccgtgcgcatttcaatgaaatgattaaggcagtggacgccggtgtt
gatttattaggttacactagctgggccccgattgatttagtaagtgcttcaacttcgcaa
atgtctaagcggtatggttttatttatgtagacgaagatgacttaggtaatggttcgctt
aagcgttatcgcaaagattcttttacatggtatcaaaaggtaattcagacaaatggaact
agtctagattag

DBGET integrated database retrieval system