KEGG   Lactobacillus plantarum WCFS1: lp_3170Help
Entry
lp_3170           CDS       T00115                                 

Gene name
pmg9
Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00010  Glycolysis / Gluconeogenesis
lpl00260  Glycine, serine and threonine metabolism
lpl00680  Methane metabolism
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01120  Microbial metabolism in diverse environments
lpl01130  Biosynthesis of antibiotics
lpl01200  Carbon metabolism
lpl01230  Biosynthesis of amino acids
Module
lpl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lpl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_3170 (pmg9)
  Energy metabolism
   00680 Methane metabolism
    lp_3170 (pmg9)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_3170 (pmg9)
Enzymes [BR:lpl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     lp_3170 (pmg9)
Membrane trafficking [BR:lpl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    lp_3170 (pmg9)
Exosome [BR:lpl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   lp_3170 (pmg9)
  Exosomal proteins of melanoma cells
   lp_3170 (pmg9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF2283
Motif
Other DBs
NCBI-GeneID: 1063992
NCBI-ProteinID: YP_004890715
UniProt: Q88T35
Position
complement(2827652..2828344)
Genome map
AA seq 230 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKAAGQKVKEAGLEFDYAFTSVLTR
AIKTLHYVLEESDQLWIPETKTWRLNERHYGALQGLNKKETAEKYGDDQVHIWRRSYDVL
PPLLSADDEGSAVNDRRYADLDPNIVPGGENLKVTLERVMPFWEDQIAPKLLDGKNVIIA
AHGNSLRALSKYIEQISDDDIMDLEMATGEPVVYDFDEKLKVLGKEKLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagtattgattcgtcacggtcaaagtgaatggaacttatctaaccaattt
actggttgggttgacgttgatttaagcgaaaagggtgttgaagaagctaaggctgctggt
caaaaagttaaagaagcaggcttagaattcgattacgcctttacttcagttttgactcgt
gccatcaagactttgcactatgtgcttgaagaatccgaccaactctggattccagaaacc
aagacttggcgtttaaacgaacgtcattatggtgcattacaaggattgaacaagaaggaa
accgctgaaaaatacggtgacgaccaagttcatatctggcgtcgttcttatgatgtttta
cctccattattgagtgccgatgatgaaggttcagccgttaacgatcgtcgttacgctgac
ttagaccctaacatcgtccctggtggcgaaaacttgaaggttaccttggaacgcgttatg
cctttctgggaagaccaaatcgcacctaagttattagacggcaagaatgtaatcattgct
gcccacggtaactcattacgtgccttaagcaagtacatcgaacaaatcagtgatgatgat
atcatggaccttgaaatggctactggcgaaccagttgtctatgactttgatgaaaagtta
aaggttcttggtaaggaaaagttaggcaaataa

DBGET integrated database retrieval system