KEGG   Lactobacillus plantarum WCFS1: lp_3294Help
Entry
lp_3294           CDS       T00115                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lp_3294 (folP)
Enzymes [BR:lpl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     lp_3294 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2930930..2932078)
Genome map
AA seq 382 aa AA seqDB search
MLVQDITSSLAQATDFASQALNAQVQRQQQLVLRFSDYNREQQLRLTQLCQQLDGVVQAS
PEQLTVLLNQTAGRQLTHQWSRVFTDQATTQIQLTQIMKQYDVFWQAGEHRFNLTKKPMI
YGIMNITPDSFFDGGQYKTKDDVLNHVDAMLQAGADVIEVNGQTTRPGFTEVTPQVELDR
TLPYIRAIKARFPEAVLAVDTYKYDVMQAVLEEGVSIINDVNAFTDDPRKLKLMADSRVG
LLTMHSSRDQEYTDLTSSMRGFFEQNLAALTSHGIDIERIALDQGIGYSQVAHGEQDYVM
MRNIDEFNYLRRPMMVAISRKGYLGLLLGLKKEDRLPMTLVTEAAMMLKGGRIIRVHDVA
ETKQLITLLGRIENGYWLSNND
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttagtacaagatatcaccagttcattagcacaagcaacggattttgcgagtcaggcg
ttgaatgcccaagttcaacgacaacaacaattagttttgcgttttagtgattataatcgg
gagcagcagctccgattaacccaactatgtcagcaattagatggggtcgtgcaggcgagt
cctgaacagttgaccgtcttgctgaaccagacagctggtcgccagttaacacaccaatgg
tcgcgagtctttacggatcaagcaacgactcaaattcaattgactcaaattatgaaacaa
tatgatgttttttggcaagcgggtgagcaccggtttaatctcaccaagaagccgatgatt
tatggcatcatgaatattacgccggactcctttttcgacggtggccagtacaagactaaa
gatgacgtactgaatcacgtggatgccatgttacaagcaggagctgacgtaatcgaagtt
aatggtcaaacgacacggccgggcttcacggaagtcacgccgcaagttgaattagaccgg
acgttgccgtacattcgcgccatcaaggctcgtttcccggaagcagtcttagcggtcgat
acttataagtatgatgtcatgcaagccgtcctggaagaaggtgtcagcattattaacgat
gtgaacgcctttacggacgaccctcgcaagctcaaattgatggctgacagtcgcgtcggc
ttactgactatgcacagtagtcgtgaccaagaatataccgatctgacgagcagtatgcgt
ggtttctttgaacaaaatctggcagcattgacgagtcatggcatcgatattgaacgaatt
gctctagatcagggaatcggctattcacaagtcgcacatggggaacaggattacgtgatg
atgcgtaacattgatgaatttaattatttgcgacgcccaatgatggtggccatttcacgg
aaaggttatttaggtctattgcttggtctgaagaaggaagaccggctaccaatgacgttg
gtcactgaagcagcgatgatgcttaagggtggccggatcatccgggtccacgatgtggct
gaaaccaagcaattgattacgctgttaggccgaattgagaatggctattggttatcgaat
aatgattag

DBGET integrated database retrieval system