KEGG   Lactobacillus plantarum WCFS1: lp_3469Help
Entry
lp_3469           CDS       T00115                                 

Gene name
lacA
Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    lp_3469 (lacA)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     lp_3469 (lacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3074498..3076549)
Genome map
AA seq 683 aa AA seqDB search
MSNPLKTTEFLHGGDYNPDQWLDQPEVIKQDFKAFKAAKLNTVTLGIFAWDKLEPAEGQY
DFSWLDQIFDRAEAQGTKIILSTPSGARPRWLAEKYPEVLRVNEHGQRNQFGERHNHCYT
SPVYREKVQMINQKLAERYGQRPSLLLWHISNEYGGACYCDLCQQAFRHWVQKKYQTLTN
LNHAYCGAFWSHDYTSWDQVQAPSPLGDTNVMGLNLDWHRFVTDRTIDFFDNEIKPLRAL
TPNIPVTANFMGGNPSESHVFYDLDYQKFAKHVDIVSWDSYPNWSNGYESTAHLAMKTAL
MNDVMRSLKHDNYLIMESTPSQVNWHPYNRAKRPGMHEMGSLQQVAHGADSVLYFQLHQS
LGASEMFHGAVIANHRGSNSRAFKDVQKVGQDLQSLQAAHGTTRTAAKVAIVFDYDNMWG
LDDARNYANETKKYWRTIQEHYQYFWKHDIPVEIIATTDDLTAYDLVIDPMHFMMSAQFA
TKLKAYVQQGGHLIGTYITGVVDHDFLAYQGDGLADLEATYGIKVQETDTLYPQQHNALT
AYHQAYQVNDYCDVVETTTAQVLGTYQKDFYAGTPAVTVNQLGQGAAYYLAARTDTDFLD
AFYERLATSLALKPALPVIKANAKVSIQVRENATTRYYFVINFSHRPTTVTLEVPLRQIF
ENQVVSGKQDLASYGVQVYMMNK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaatccattaaagacaacagaatttttgcatggtggtgattataatccagaccag
tggcttgaccaacccgaggtgattaagcaggattttaaagcgtttaaggctgctaagtta
aatacggtgacattgggaatctttgcttgggacaagttagagcctgctgaggggcagtat
gattttagctggttagatcaaattttcgatcgtgccgaagcccaagggactaagatcatt
ttgtcgacgccaagcggggctcgtccacgctggttagctgagaaatatccagaagtgtta
cgtgtcaatgaacacggacagcgaaatcaattcggcgagcgacataatcactgttacaca
tcgccagtttaccgagaaaaggttcaaatgattaaccagaagttggcggaacgttacggt
caacgaccaagcttgctgctatggcatatctctaatgaatatggcggtgcttgttactgt
gatttgtgccagcaagcctttcgtcattgggttcaaaaaaagtatcaaacgttaaccaat
ttgaaccatgcttactgtggtgctttttggagtcacgattatacaagttgggatcaggtt
caggcaccgtcgccgctgggtgatacgaatgtaatgggacttaacctggattggcatcgt
tttgtaacagaccggacgattgacttttttgataatgagatcaaaccgttacgagcgctg
acacctaatatccctgtgacagccaattttatggggggtaacccatcagaatcacacgtc
ttttatgatttagattatcagaagtttgcgaagcatgtcgatattgtgagttgggattca
tatcctaattggagtaatggttacgaaagtacggcccacttggccatgaaaactgctttg
atgaatgacgtgatgcggagcctcaagcatgataactacttaattatggaaagtacaccg
tcacaggttaattggcacccatataatcgtgccaaacgaccaggcatgcacgaaatgggg
agcttgcaacaggttgcccatggcgccgactcagttttgtatttccaactacatcaatca
ttaggagcttctgaaatgtttcatggcgccgtcattgccaaccatcgtggctcaaattcg
cgggcatttaaggacgttcaaaaagttggtcaggacttacaaagcttacaggccgcgcat
ggaacgaccagaactgcagctaaagtcgctattgtctttgattatgacaacatgtggggc
ttagatgatgcccgcaactacgctaacgaaactaaaaagtattggcgcacgattcaagaa
cattaccagtatttctggaaacatgatattccagttgaaattattgcgactactgatgat
ttgacagcctatgatttggtgattgatccgatgcacttcatgatgagcgcccagtttgcg
actaagcttaaagcatatgtgcaacagggcggccatctgatcggcacctatattacgggc
gtcgttgatcatgacttcttagcctatcaaggtgatgggttagctgacttagaagcaact
tacggaattaaagttcaggaaactgacacattatatccgcaacaacataatgcactgact
gcttatcaccaagcgtatcaagtgaatgattattgtgatgtagttgagacgacaacggca
caagtcctcggcacgtatcaaaaagacttttatgctggaacaccggctgtaacggtcaat
caattgggccagggagcggcgtattatttggctgcgcggaccgatactgacttcttggat
gctttctatgaacggcttgccacaagtttggcacttaaaccggccttgccagtgatcaaa
gcgaatgccaaggtaagtattcaagttagagagaatgcgacgacgcgctattacttcgtg
atcaattttagtcatcgaccaacgacggtgacacttgaagtgccgttacggcagattttt
gagaatcaagtggtcagtggcaagcaagacttggccagctatggtgttcaagtctatatg
atgaataaataa

DBGET integrated database retrieval system