KEGG   Lactobacillus plantarum WCFS1: lp_3483Help
Entry
lp_3483           CDS       T00115                                 

Gene name
lacL
Definition
beta-galactosidase, large subunit
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    lp_3483 (lacL)
  Lipid metabolism
   00600 Sphingolipid metabolism
    lp_3483 (lacL)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    lp_3483 (lacL)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     lp_3483 (lacL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3091774..3093654
Genome map
AA seq 626 aa AA seqDB search
MQANLQWLDDPEVFRVNQLPAHSDHHYYHDTAEFKTGSRFIKSLNGAWRFNFAKTPAERP
VDFYQPDFDATDFDTIQVPGHIELAGYGQIQYINTLYPWEGKIYRRPPYTLNQDQLTPGL
FSDAADNTVGSYLKTFDLDDAFKGQRIIIQFQGVEEALYVWLNGHFIGYAEDSFTPSEFD
LTPYIQDQGNVLAVRVYKRSTAAFIEDQDMFRFSGIFRDVNILAEPASHITDLDIRPVPN
ANLKSGELNITTKVTGEPATLALTVKDHDGRVLTSQTQTGSGSVTFDTMLFDQLHLWSPQ
TPYLYQLTIEVYDADRQLLEVIPYQFGFRTVELRDDKVIYVNNKRLVINGVNRHEWNAHT
GRVISMDDMRADIQTMLANNINADRTCHYPDQLPWYQLCDEAGIYLMAENNLESHGSWQK
MGAIEPSYNVPGDNPHWLAAVIDRARSNYEWFKNHPSIIFWSLGNESYAGEDIAAMQAFY
KEHDDSRLVHYEGVVHTPELKDRISDVESRMYEKPQNIVAYLEDNPTKPFLDCEYMHDMG
NSLGGMQSYNDLIDKYPMYQGGFIWDFIDQALFVHDPITDQDVLRYGGDFDERHSDYEFS
GDGLMFADRTPKPAMQEVKYYYGLHK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaatcttcaatggttagatgacccagaagtcttccgggtcaaccaattacct
gcacatagtgatcaccattattatcacgacacagcagaattcaaaacgggtagtcgcttc
atcaagagtctcaatggcgcttggcgttttaacttcgccaagacaccggctgaacgccca
gttgatttttatcaacccgatttcgatgcaaccgactttgatacgattcaagttcccggt
catattgaactagccggctatggtcaaattcaatacattaacacgctatacccatgggaa
ggtaaaatttatcgtcgcccaccgtataccctcaatcaagatcaattaacaccaggccta
ttcagcgacgctgcggacaacaccgtcggctcgtacctcaaaacctttgatctcgacgat
gcttttaaagggcaacgtattatcattcagttccaaggggtagaagaagccctgtacgtc
tggttaaatggccattttattggctacgctgaagatagtttcaccccttcagaatttgat
ttgacgccgtatattcaggaccaaggtaacgttttagcggttcgggtctacaaacgcagt
actgctgcctttattgaagaccaagatatgttccgtttctctggtattttccgtgacgtc
aatatactggcggagcctgccagccatattactgatttggacatccgaccagttccaaat
gccaatctcaaaagtggtgagctcaacatcactactaaagtaaccggtgaaccagccact
ttagcgctgaccgttaaagaccatgacgggcgagtactgacgagtcaaacgcaaaccggt
agtggcagtgtaacctttgataccatgttattcgaccaactgcacttgtggtcaccacaa
acgccgtatctctatcaattgacaattgaagtttacgatgctgatcgccaactcttggaa
gtcatcccatatcagtttgggttccggacggtcgagctgcgcgatgacaaagtcatttac
gtcaacaataaacggttggtgatcaacggggttaaccggcacgaatggaacgcccacacc
ggtcgcgttatcagtatggatgatatgcgcgctgatatccaaaccatgttagctaacaat
atcaatgccgatcggacctgccattatcctgatcaattaccttggtatcaattatgtgac
gaggccggtatctacctaatggccgaaaacaacctcgaatcgcacgggtcatggcaaaag
atgggtgctatcgagccttcttacaatgttcctggcgataatccacactggttagcagcg
gtgatcgaccgggcccgttcgaactacgaatggtttaaaaaccacccatcgatcattttt
tggtcacttggcaatgaatcgtatgctggcgaagatatcgcggcgatgcaggctttttat
aaagaacacgatgattcacgactcgtccactacgaaggtgttgtccacacaccagaatta
aaagatcgcatttctgatgttgaaagtcggatgtacgaaaagccccaaaatattgtagct
tacttggaagataacccaaccaaacctttcctagattgtgaatatatgcatgacatgggg
aattctctgggcggtatgcaatcatataatgatttgatcgacaagtatccgatgtatcaa
ggtggctttatttgggactttattgatcaagccctcttcgttcatgacccaattaccgac
caagacgtgctccggtatggcggtgatttcgacgaacgccactccgattatgaattctcc
ggtgacggcttaatgtttgccgaccggacaccaaaaccagcaatgcaagaggtgaaatat
tattatggcttacacaaataa

DBGET integrated database retrieval system