KEGG   Lactobacillus plantarum WCFS1: lp_3485Help
Entry
lp_3485           CDS       T00115                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lpl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lpl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lpl00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3094697..3096913)
Genome map
AA seq 738 aa AA seqDB search
MAVTLQQTLIDIDEEQLVFHLHNDQISYILGVETGNVLAHLYFGPRVRGYHGERQYPRID
RGFSGNLPNTTDRSYSKDDLPQEYGGNNTGDYRQPAAIIRAANGARTVDFRYQDCRMEAG
KPELKGLPQTYVEDEDEAQTLIVTLRDATLGVTLELAYTIYRDRPVITRSARLINHSEQA
VDLEKVASMQMDLPTQPLDAISLPGSYARERQLSRERLHRGVTQFESRRGASSHHMNPFV
ALADPNTNEFQGNVLGALLIYSGNHQISLERDPIGQTRLTMGINEYNFDWRLAAGDSFQT
PEVAMVYSTTGLNGMSQTYHDLLRDRVARSRYKHDLRPILINNWEATYFDFDADKIQSIL
DAAAPLGIEMFVLDDGWFGHRNDDNSSLGDWFVNRNKLPGGLADISKRTHDKGMRFGLWF
EPENISADSDLYRAHPDWVLGVPDRGRTLSRNEYVLDFSQPDVVDNIFEQMTAVLDKVPI
DYIKWDMNRNLTEVYSPHSDSTHEGETSHRFILGVYDLMERLTKRYPQILFEGCSGGGGR
FDAGLMYYMPQSWPSDNNDPIERLKIQYGTSLVYPISAITAHVGTSPDELLGRSTSMKMR
GAVAMSGTLGYELDAAQLSDADKQAVKRQVAFYKQHRELVQYGTFYRLESPFESNTVAWM
FVSPDQKEALLFTFVILGAVQPEPHITKLAGLDPQQTYVETDTNKMYGGDELMQLGLYTT
PVQTSDFTAQVHYFKAKD
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacgttgcagcaaactttaattgacattgatgaagaacaacttgtctttcac
ctgcataacgatcaaatctcgtatattctaggtgtggagacaggcaacgtgttggcccac
ttgtactttggcccacgggttcggggttatcatggcgagcgtcagtatccccggattgat
cgggggttctcaggaaatttaccgaatacgactgatcgaagctattccaaggatgatttg
ccacaggaatacggtggcaataataccggtgattatcggcaacccgccgcgattattcgc
gcggccaatggtgctcgaacagttgattttcgttatcaagactgccggatggaagccggt
aagccggaacttaagggcttgccacaaacttatgtcgaagatgaggatgaagcccaaact
ttgattgtgacgttgcgagatgccacattaggcgtgacactcgaattagcctacacgatt
tatcgggatcggccagttatcacgcgtagcgcccggttgattaatcacagtgagcaagct
gtcgacttagaaaaagtggcttcgatgcagatggacctgccaacccaaccattagatgcc
atttcgttacctggaagctatgcgcgtgagcgccagcttagtcgtgaacggctccatcga
ggtgtaactcagtttgaaagtcgccggggtgctagttctcatcatatgaatccttttgtg
gcgctagctgatccgaatactaatgaatttcaaggcaatgtccttggtgcattgctaatt
tattcaggtaaccaccagattagtttagaacgggacccaattggtcagacacgcttgact
atgggaatcaatgaatataacttcgactggcgattggcggccggtgatagtttccaaacg
cccgaggttgcaatggtatactcgacgacggggcttaatggtatgtcgcaaacctaccat
gatttattgcgtgatcgcgtggcgcgcagtcgttacaagcacgatctccggccgatcttg
atcaacaattgggaagccacttactttgactttgatgcggacaagattcaatcaatcttg
gatgctgcagcaccactgggtatcgaaatgtttgtgctggatgacggttggttcggtcat
cgaaatgatgataatagttcgctaggtgactggtttgttaatcggaacaagttaccagga
ggcttagcggatattagcaaacggacccatgataaagggatgcggttcggactttggttc
gagccagaaaatatttcagccgattccgatctttatcgggcccatcctgattgggtgtta
ggcgtaccagatcgtggccgaacgttatcgcggaacgaatacgtgcttgatttcagccag
ccggatgttgtcgacaatatttttgaacaaatgaccgcagttcttgataaggtgcccatt
gattatatcaagtgggatatgaaccgcaatttaacggaagtctattcgccacatagcgat
tcaactcatgaaggtgagactagccaccgctttatcttaggtgtatatgacttgatggag
cgtttaacaaaacgctatccacagatcttatttgaaggctgctctggcggtggtggccgc
tttgatgctggtttaatgtattatatgccacagagttggccatcagataataatgacccg
attgaacggctcaaaattcaatatgggacttcactcgtttatccaatttctgcaattacc
gcccatgttgggacgagcccagatgaattgttaggacggtcgacgtcgatgaagatgcgt
ggtgctgtggcaatgagtggtaccttgggctatgaactggacgcggcccaactaagtgat
gcggacaagcaggccgttaaaagacaggttgccttctataagcagcaccgtgagttagtt
caatacgggaccttttatcgattagagagcccgtttgaatctaatacggtggcgtggatg
tttgttagtccggatcagaaagaagccttgctgttcaccttcgttattttaggtgcagtt
caaccagaaccgcatattacgaagttagcgggattagaccctcagcagacctacgttgag
accgacacaaacaaaatgtacggtggcgatgaattgatgcaactaggactctacacgact
cccgttcaaactagtgactttacggcgcaggtacattacttcaaggctaaggactaa

DBGET integrated database retrieval system