KEGG   Lactobacillus plantarum WCFS1: lp_3645Help
Entry
lp_3645           CDS       T00115                                 

Gene name
gcnA
Definition
beta hexosamidase or lacto-N-biosidase or beta N-acetylglucosamidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpl00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lpl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3264555..3266405)
Genome map
AA seq 616 aa AA seqDB search
MITWQGLTTEQVQSVQAVCAAIMPTSDLSVECQHATTGIHIQRNGDQARLTYGSMAELMH
GAALLCGRARKATQFDIRQQPRFEVLAAMLDVARNGVPTVAMIKQIIRRLASMGYNELWL
YLEDLFEIPEAPYFGRGRGRYQQTELHEIALYGDRFGVTIVPAVQTLAHLHNALKWDAHA
AVKDTDDTLLVGAPATKDFLTNLLRAASAPFTTNKIHVGMDEAYQLGRGRYLDQNGFTDQ
ETLILQQLQLVVSLTQKLGLKAYMWSDLWFTFASSKHEMYDPDVHFDPAFKASLPPVGQV
YWDYYHEDEQTYRERFTQHFELSDDVAFAGGIWTWSALAPNQSKMLATIDAGLKAAKASG
VQQVVATMWFDDGAEVPFSAAWYGLQAFATYQYYEDVTPAMIDTEYAMIQGENATFYRLL
DQFDNFTSKVNVDADNVSKLILYEDLMLQRYRSNLAVIDVEAHYLDLMTKLDQVHVHQEN
QLMVTFYKQLARTVLVKQRALKVVVALADSDVTKLRADSARAAVTSCQHALEQLLRDFRA
LWQQQRRGNGFEVIDVRLGGQIARCETVTWRIDEWLAGRDDLAELREPLLPMDKRNNGLV
GHGLYKEIVSACELSF
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgataacgtggcaagggttgactactgagcaagtacagtcagtacaggcggtttgtgcc
gcaatcatgccgacaagcgatcttagtgttgaatgccagcatgcgacaactggtattcac
attcaacgcaatggtgatcaggcgcgtctcacatatggcagtatggcagagttgatgcat
ggtgctgcattgttatgtggtcgagcccggaaagcaacgcaatttgatattcgacagcag
ccaagatttgaagtgctggctgccatgctcgatgttgctcgtaatggcgtaccaacagtt
gcaatgataaagcaaatcatccggcgactagcaagcatgggttacaatgagttatggcta
tatttagaggatctgtttgaaatcccagaggcaccatattttggtcgtggtcgtggtcgt
tatcagcagaccgaattacatgagattgctttgtatggtgatcgttttggtgtgacgatc
gttccagctgttcagaccttagcacatctgcataatgcgttaaagtgggatgcgcatgcg
gcagtcaaagacacggacgatacgttactggtgggagcacctgcaacaaaggatttcctc
actaatcttttgcgtgcggcgagtgccccgttcacaactaataagattcacgttgggatg
gatgaagcctatcagcttggccgtggacgctatttagatcaaaatgggtttacagatcaa
gaaacacttatcttacaacagttacaattagtcgtatcgttaactcagaaattaggttta
aaagcttatatgtggagtgacttatggtttacattcgcttcatcaaagcatgaaatgtat
gatccggatgtgcattttgaccctgcctttaaagcgagtttaccgccagtcggtcaagtt
tattgggactattaccatgaagatgaacagacttatcgtgagcgctttacccaacacttc
gaacttagtgatgatgtggcgtttgcgggcggaatctggacgtggagtgctttggcacct
aatcaaagtaagatgctggcaacgattgacgcgggcttgaaagctgccaaagcgagtggc
gtgcagcaagtagttgcgacaatgtggtttgacgacggcgcagaagtaccttttagtgca
gcgtggtatggcctacaagcttttgcaacttatcagtattacgaggatgtcacaccggcg
atgatcgatacagaatatgccatgatacagggcgaaaacgcgactttttatcgactctta
gatcaatttgataactttacgagtaaagttaacgtcgatgctgataatgtgagcaagttg
attctttatgaggatctaatgttgcagcgataccggtctaacttagcagttattgatgtt
gaagctcattatctggacttaatgacgaagcttgatcaggtacacgtccatcaagaaaat
caattgatggtgaccttttacaagcaattggcacggacggttttagtaaaacaacgagct
ctaaaggtagtggtagcccttgctgattctgatgtaaccaaattacgggctgactcggct
cgagcggcggtgacaagttgccagcatgcactggaacaattattacgcgattttcgagcg
ctttggcagcaacaacggcgtggaaatggctttgaggttatcgatgttcgattaggtggt
caaatcgcgcgctgtgagacggttacttggcgtattgatgaatggctagcaggacgtgat
gacttagctgaattgcgagaaccgttattaccaatggataagcgcaataacggattggtc
gggcacgggctgtataaagaaattgtgagcgcctgtgaattgtcattttag

DBGET integrated database retrieval system