KEGG   Lactobacillus plantarum WCFS1: lp_3662Help
Entry
lp_3662           CDS       T00115                                 

Gene name
adhE
Definition
bifunctional protein: alcohol dehydrogenase; acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    lp_3662 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_3662 (adhE)
   00620 Pyruvate metabolism
    lp_3662 (adhE)
   00650 Butanoate metabolism
    lp_3662 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    lp_3662 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    lp_3662 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lp_3662 (adhE)
   00626 Naphthalene degradation
    lp_3662 (adhE)
Enzymes [BR:lpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lp_3662 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     lp_3662 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3282610..3285213)
Genome map
AA seq 867 aa AA seqDB search
MIKTEKNQTSKVTDEVDQLVQRSKKALAILKSYTQAQIDDLCEKVAVAALDNHMKLAKLA
VEETGRGVVEDKAIKNIYASEYIWNSMRHDKTVGVIKEDDEEQLMEIAEPVGIVAGVTPV
TNPTSTTVFKTLISLKGRNTIVFGFHPQAQKCSSAAADVMREAIKAAGGPADAVLYIEHP
SIEATDALMHHTDVATILATGGPSMVTAAYSSGKPALGVGPGNGPTYVEKTADIKQAVND
IVLSKTFDNGMICASENSAIIDKEIYAEVKAEFIRLGCYYVKPKDVQALSDAVIDPNRHT
VRGPVAGKTAYQIAQMAGLKDVAKDCRVLIAEINGVGIKYPLSGEKLSPVLTVYKADSHE
AAFKRANELLHYGGLGHTAGIHTTDDALVKEFGLQMPACRILVNTPSSVGGLGNIYNNMA
PSLTLGTGSYGGNSISHNVTDMDLINIKTVAKRRNNMQWVKMPPKVYFERNSVRYLEHMA
GIKKVFLVCDPGMVEFGYADRVTAVLNKRTDPVDIDIFSEVEPNPSTDTVYKGVARMKAF
KPDTIIALGGGSAMDAAKGMWLFYEHPEASFLGAKQKFLDIRKRTYKVPVSEKVTYIGIP
TTSGTGSEVTPYAVITDSKTHVKYPITDYAMQPDIAIVDPQFVETVPKRTTAWTGLDVIT
HATEAYVSTMASDFTRGWSIQALQLAFKYLKASYDGDKMAREKMHNASTLAGMAFANAFL
GINHSIAHKLGGEFNLPHGLAIAITYPQVVRYNAEIPTKLAMWPKYNHNTALADYANIAR
ALGLPGKTDEELKESLVKAYIDLAHSMDVTLSLKANRVEKKHFDATVDELAELAYEDQCT
TANPREPLISELKAIIEREWDGQGTEK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgattaagacagaaaaaaatcaaacaagcaaagttactgacgaagttgatcaattagtt
caacgttctaagaaagcattagctattttgaagtcatatacccaagcacaaatcgatgat
ttatgtgaaaaggttgcggttgccgcactggacaatcatatgaagttagccaagttggcg
gttgaggaaaccggtcggggtgttgttgaagataaggcgattaagaacatctacgccagc
gaatatatctggaacagcatgcgccatgataagacagtcggcgtcattaaagaagacgat
gaagagcaactaatggaaattgctgaaccagttggtatcgtagccggggttacacccgta
acgaatccaacttcaacaacggttttcaagacgttgatctcattaaaggggcgtaacacg
atcgtctttggtttccatcctcaagctcagaaatgtagttctgcggctgctgatgtgatg
cgggaagcgattaaagctgctggtggtccagctgatgctgttttatacatcgaacaccca
agcattgaagcaaccgacgccttgatgcaccatacggatgttgcgacgatcttggctacc
ggtggtccaagtatggtgacagccgcttactcatcaggtaaaccagcactgggtgttggt
cctggtaacggcccaacttatgttgaaaaaacagctgacattaagcaggcggttaacgac
attgttttatcgaagacgtttgataatgggatgatttgtgcttctgaaaatagtgccatt
atcgacaaggaaatttatgctgaagttaaagctgaatttattcgtttgggttgctactac
gttaaacctaaagatgtgcaagccttgagtgatgctgtcattgatcctaaccggcacaca
gttcgtggtccagttgctggtaaaacagcttatcaaatcgcacaaatggctggcttgaaa
gatgtcgctaaggactgccgggtcttgattgcggagattaatggtgtcggtatcaagtac
ccattatccggcgaaaaattatcaccagttctgaccgtttacaaagcggattcgcatgaa
gcggcgttcaaacgggctaatgaattacttcactatggtggcttaggccatactgctggg
attcatacgaccgatgatgcattggtcaaagaatttggcttacaaatgccagcttgccgg
atcttagttaacacgccatcttcagttggtgggttaggtaacatctacaataacatggcg
ccttcattaactctgggcacgggatcatatggtggcaactcgatttctcataacgttaca
gatatggatctgattaatatcaaaactgtggcaaaacggcgtaataacatgcaatgggtc
aaaatgcctcccaaagtctacttcgaacgcaattccgttcgctacttggaacacatggcc
gggattaagaaggttttcctagtttgtgatcctgggatggttgaatttggctatgctgat
cgagtaacggcggtcttgaacaagcggactgatccggttgatatcgacatcttctcagaa
gttgaaccgaacccgtcgactgacacagtctacaaaggggttgcccggatgaaggccttt
aagccagatacaatcattgcactcggtggtggttctgcaatggacgccgctaaggggatg
tggctcttctatgaacacccagaagcttccttcttaggtgctaaacagaagttcctggat
atccggaagcggacgtacaaagtaccagtatccgaaaaagtaacttatattgggattcca
acgacttctgggactggttctgaagtaacgccatacgcggttattacggactccaagacg
cacgtcaaatacccgattacggactacgcaatgcaaccagatattgcgatcgttgaccca
caatttgttgaaacggtgccaaagcggacgacggcttggactggtctcgacgtaattacc
cacgcaaccgaagcatatgtttcaacgatggcttctgacttcacacgcggctggtcaatt
caagccttgcaattagccttcaagtacttgaaagcttcttatgatggtgacaagatggct
cgtgagaagatgcacaatgcctcaacgttagctgggatggcctttgccaatgccttcttg
ggtatcaaccactcgatcgcccataaattaggcggggaattcaacttaccacacggattg
gcaattgcgatcacttatccgcaagtcgttcgttacaatgctgaaatcccaacgaagtta
gcaatgtggccgaagtacaaccataatactgccttagccgactatgccaacattgcccgg
gccttagggttaccaggcaagaccgacgaagaactcaaagaaagcttagttaaagcttac
attgacttggctcactcaatggatgtgaccttatccttgaaagctaaccgggtcgaaaag
aagcactttgacgccaccgtcgacgaattagccgaactggcctatgaagaccaatgcacg
accgctaacccacgcgaacctttaatcagtgaattaaaggcgattattgaacgtgaatgg
gacggccaaggtactgaaaaatag

DBGET integrated database retrieval system