KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0246Help
Entry
LP6_0246          CDS       T02689                                 

Definition
(GenBank) glutamate dehydrogenase
  KO
K15371  glutamate dehydrogenase [EC:1.4.1.2]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
lpm00220  Arginine biosynthesis
lpm00250  Alanine, aspartate and glutamate metabolism
lpm00430  Taurine and hypotaurine metabolism
lpm00910  Nitrogen metabolism
lpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpm00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    LP6_0246
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LP6_0246
   00220 Arginine biosynthesis
    LP6_0246
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LP6_0246
Enzymes [BR:lpm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     LP6_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_GDH ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AGN13170
Position
complement(289450..292812)
Genome map
AA seq 1120 aa AA seqDB search
MMTNSWKDKLQKQLTQQFGSPKGKQLIDKYTETMSMSYSEQHTPEEAIQDILQIEKLSKE
NPLVIDFYENTHSQYPLHIKLYRYETPIPLSDILPMLENMGLRTYTERPYKIKTRDGQLF
WISDFNVTYSQTDSINITQVKDIFAEALISINLGICENDGFNKLVLCAGLSWQEITILRA
YAKYLHQIGIRYSQSYIEKTIEMHAAIARELIHFFYLKFGLKRKSAIHKDILALEQKIQI
NIDAISSLDEDRIMRYFWSLMKATLRTNYFQKNHAGLSKDYLSFKLKSSEIPDLPPGQPL
YEIFVYSTRFEGIHLRSTKVARGGIRWSDRPEDFRTEILGLMKAQKVKNAVIVPSGAKGG
FVLKKPLHAASREQIQQEVISCYKSFINGLLDLTDNLINDKTIPPQNVICYDDPDPYLVV
AADKGTATFSDIANSIAKEHGFWLGDAFASGGSAGYDHKKMGITARGAWESVKRHFRELD
INIQQQDFTVVGIGDMSGDVFGNGMLYSKHIRLLAAFDHRHIFLDPNPDPVKSYEERLRL
FNLPTSSWEDYNLQLISKGGGVYKRSSKSIPISPQVKKALAIDANALTPNELIRALLKAP
VDLLFNGGIGTYVKATTESHADVGDKTNEFCRINGAELHCKVVGEGGNLGFTQLGRVEFA
LKGGLINTDAIDNSAGVNCSDHEVNIKILLDKEIREKKLTEKKRNQLLSRMTDEVADLVL
QDNYNQALILSISAAHSSHYSGLYQDYMKELEKWVNLDRSVEFLPDDKKLLERKSTGAGL
TRPELAVLMAHTKIHIANELLKSHLPDDSYFTTFLETGFPISLRKPYAKALPKHPLSREI
IATQLSNKLVNNMGITFMYRMLMETGMSIADIACAYTISACIFQTDVLQNLIDSFQDKIS
LSTQYELLHHIRQLLNLATRWFLHNNRLTGGIEKNIKNYGKSVKKLELLIPKLMGGVTKE
YLEKLISQFVSIGIEKDMAQKIAITRALYTSLNIIEVATQNEFDLSLTAETYFKVGSQFN
LVWFRDQIANDSREGHWNTMARLSLRDELDNLQRRLTIAILTTNTKERTSEKLINYWLEQ
NHPIQKRWEKLLEMLLGSENIDYTIFFIALRELSSLIQVL
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaactcatggaaagataaattgcaaaagcaattaactcagcaatttggctcc
ccaaaagggaaacagctcattgataaatacaccgaaacaatgtcaatgagttatagtgaa
caacatactcccgaagaggcaatccaggacattttacagatagaaaaactctccaaagaa
aatcccctggttatcgatttttatgaaaacactcactcacaatatcctttgcacattaaa
ctttatcggtatgaaaccccaatccccctatccgacatcttgcctatgcttgaaaacatg
ggactgcgcacttataccgaacgtccttataaaatcaaaacacgggacgggcaattattc
tggattagtgattttaacgtaacctattctcaaaccgattcaatcaacattactcaggtc
aaagatatttttgcagaggcactgattagtatcaatcttggtatttgtgaaaacgatggt
tttaataaattggtattatgcgcggggctctcctggcaagaaataactattttgcgagcc
tatgcaaaatacctccatcagattggtattcgttacagtcaatcttacattgaaaaaacc
atcgaaatgcatgcggccattgcccgtgagctgattcacttcttttatttgaaatttggc
cttaaaaggaaatctgctattcacaaggacatattggcactagaacagaaaattcaaata
aacattgatgcgattagcagcctggatgaggatcgcatcatgcgttatttttggtctttg
atgaaagcaactcttcgtactaattactttcaaaaaaatcacgcgggattatctaaagat
tacctttccttcaaattaaaatcctcggaaattcctgacctacctccaggtcaaccgctt
tatgaaatttttgtgtactcaacacgttttgaaggaatccatttacgtagtaccaaagta
gcccgcggcggtattcgctggtccgatcggccagaagattttcgaaccgagattttagga
cttatgaaagcgcagaaggtaaaaaacgcagtcattgttccctctggcgccaagggaggt
tttgtcttgaaaaaaccgcttcatgcagccagccgcgagcaaatccaacaggaagtcatc
tcttgttataaatcgttcatcaatggtttactggatctcaccgataatttaatcaatgat
aaaacaatccctccacagaatgttatatgttacgacgaccctgacccttatctggttgtt
gctgctgacaagggaacagctactttttccgatattgccaatagtattgccaaggaacat
ggattttggctaggtgatgcttttgcttctggaggttctgccgggtacgatcataaaaaa
atgggtattacagcacgtggtgcgtgggaatctgtcaaaagacattttcgtgaacttgat
atcaatattcagcaacaagactttacggtagtaggtattggtgatatgagtggtgatgta
tttggcaatggcatgctttattcaaaacatatacggctgttagctgcttttgatcatcgt
catatttttctcgacccgaatcccgaccctgtaaaatcctatgaagaaagacttcgcctg
tttaatttacctacttcatcctgggaagattacaacttacaacttatttctaaaggcgga
ggcgtttacaaacgctcaagcaaatcgatccccattagcccgcaagtaaaaaaagctctc
gctatagatgcaaatgcccttacgcccaatgagcttattcgagcgctgttaaaagcacca
gtggatttactgtttaacggcggtattggaacctatgtcaaagcaaccacggagtcacat
gccgatgttggcgacaagactaatgaattctgccgtattaatggcgcagaattacactgc
aaggtagtgggagaaggaggaaatctgggttttactcaacttggacgcgtcgagtttgca
ttaaagggcggtcttattaacactgatgcgattgataattccgccggcgttaactgctct
gaccatgaagtcaatatcaaaattcttttagataaagagattagagaaaagaaactcaca
gaaaaaaaacgcaatcaattgctaagcagaatgacagacgaagtcgccgatcttgttttg
caagacaactacaatcaagccttgattttaagtatatcggcagctcattcttctcattat
agtggcttatatcaagattacatgaaagaattggaaaagtgggttaaccttgacagaagc
gttgaattccttcctgacgataaaaaactcctcgaacgcaaaagcactggcgcagggctg
acaagaccagagcttgctgttttaatggcacacaccaaaattcatattgctaacgaatta
ttaaaatcgcatttacccgatgactcatacttcacaacttttttggaaacaggttttccc
atctcgctacgaaagccctatgcgaaagccttgccaaaacaccctttgtctcgtgaaatc
atagcgacgcaactgagcaataagctggttaacaacatgggaattaccttcatgtaccgc
atgctgatggaaaccggtatgtcgattgctgatattgcctgcgcttacactatttcagcc
tgtattttccaaacggatgtcttacaaaatctgattgattcatttcaagataaaatatcc
ttatccacccaatatgaattattgcatcacattcgccaattgctcaacttggcgacacgc
tggtttttgcataataatcgactgaccggaggcattgaaaaaaatattaaaaattatggc
aagtcagtcaaaaaacttgaactgttgattcccaagctcatgggtggtgtcactaaagaa
taccttgagaaactcattagccaattcgtcagtattggtattgaaaaggatatggctcaa
aaaattgctataactcgggctctttatacttcattaaatatcattgaagtagccacgcaa
aatgaatttgatttatcgcttactgcagaaacttactttaaagttggtagtcaatttaat
ctcgtttggtttcgcgaccaaatagccaatgactcacgtgaagggcattggaataccatg
gctcgcctgtctttgcgtgatgagttagataatctgcaaagacgtttgactattgccatt
ttaacaactaacaccaaagaacgtacttctgaaaaattgataaactattggctggaacaa
aatcaccccattcaaaaacgctgggaaaagttattagaaatgttattgggtagcgaaaac
atagattacaccatattttttatcgccttgcgtgagctttcctctttaattcaagtattg
taa

DBGET integrated database retrieval system