KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0246Help
Entry
LP6_0246          CDS       T02689                                 

Definition
glutamate dehydrogenase (EC:1.4.1.2)
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:lpm00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lpm00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lpm00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:lpm00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(289450..292812)
Genome map
AA seq 1120 aa AA seqDB search
MMTNSWKDKLQKQLTQQFGSPKGKQLIDKYTETMSMSYSEQHTPEEAIQDILQIEKLSKE
NPLVIDFYENTHSQYPLHIKLYRYETPIPLSDILPMLENMGLRTYTERPYKIKTRDGQLF
WISDFNVTYSQTDSINITQVKDIFAEALISINLGICENDGFNKLVLCAGLSWQEITILRA
YAKYLHQIGIRYSQSYIEKTIEMHAAIARELIHFFYLKFGLKRKSAIHKDILALEQKIQI
NIDAISSLDEDRIMRYFWSLMKATLRTNYFQKNHAGLSKDYLSFKLKSSEIPDLPPGQPL
YEIFVYSTRFEGIHLRSTKVARGGIRWSDRPEDFRTEILGLMKAQKVKNAVIVPSGAKGG
FVLKKPLHAASREQIQQEVISCYKSFINGLLDLTDNLINDKTIPPQNVICYDDPDPYLVV
AADKGTATFSDIANSIAKEHGFWLGDAFASGGSAGYDHKKMGITARGAWESVKRHFRELD
INIQQQDFTVVGIGDMSGDVFGNGMLYSKHIRLLAAFDHRHIFLDPNPDPVKSYEERLRL
FNLPTSSWEDYNLQLISKGGGVYKRSSKSIPISPQVKKALAIDANALTPNELIRALLKAP
VDLLFNGGIGTYVKATTESHADVGDKTNEFCRINGAELHCKVVGEGGNLGFTQLGRVEFA
LKGGLINTDAIDNSAGVNCSDHEVNIKILLDKEIREKKLTEKKRNQLLSRMTDEVADLVL
QDNYNQALILSISAAHSSHYSGLYQDYMKELEKWVNLDRSVEFLPDDKKLLERKSTGAGL
TRPELAVLMAHTKIHIANELLKSHLPDDSYFTTFLETGFPISLRKPYAKALPKHPLSREI
IATQLSNKLVNNMGITFMYRMLMETGMSIADIACAYTISACIFQTDVLQNLIDSFQDKIS
LSTQYELLHHIRQLLNLATRWFLHNNRLTGGIEKNIKNYGKSVKKLELLIPKLMGGVTKE
YLEKLISQFVSIGIEKDMAQKIAITRALYTSLNIIEVATQNEFDLSLTAETYFKVGSQFN
LVWFRDQIANDSREGHWNTMARLSLRDELDNLQRRLTIAILTTNTKERTSEKLINYWLEQ
NHPIQKRWEKLLEMLLGSENIDYTIFFIALRELSSLIQVL
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaactcatggaaagataaattgcaaaagcaattaactcagcaatttggctcc
ccaaaagggaaacagctcattgataaatacaccgaaacaatgtcaatgagttatagtgaa
caacatactcccgaagaggcaatccaggacattttacagatagaaaaactctccaaagaa
aatcccctggttatcgatttttatgaaaacactcactcacaatatcctttgcacattaaa
ctttatcggtatgaaaccccaatccccctatccgacatcttgcctatgcttgaaaacatg
ggactgcgcacttataccgaacgtccttataaaatcaaaacacgggacgggcaattattc
tggattagtgattttaacgtaacctattctcaaaccgattcaatcaacattactcaggtc
aaagatatttttgcagaggcactgattagtatcaatcttggtatttgtgaaaacgatggt
tttaataaattggtattatgcgcggggctctcctggcaagaaataactattttgcgagcc
tatgcaaaatacctccatcagattggtattcgttacagtcaatcttacattgaaaaaacc
atcgaaatgcatgcggccattgcccgtgagctgattcacttcttttatttgaaatttggc
cttaaaaggaaatctgctattcacaaggacatattggcactagaacagaaaattcaaata
aacattgatgcgattagcagcctggatgaggatcgcatcatgcgttatttttggtctttg
atgaaagcaactcttcgtactaattactttcaaaaaaatcacgcgggattatctaaagat
tacctttccttcaaattaaaatcctcggaaattcctgacctacctccaggtcaaccgctt
tatgaaatttttgtgtactcaacacgttttgaaggaatccatttacgtagtaccaaagta
gcccgcggcggtattcgctggtccgatcggccagaagattttcgaaccgagattttagga
cttatgaaagcgcagaaggtaaaaaacgcagtcattgttccctctggcgccaagggaggt
tttgtcttgaaaaaaccgcttcatgcagccagccgcgagcaaatccaacaggaagtcatc
tcttgttataaatcgttcatcaatggtttactggatctcaccgataatttaatcaatgat
aaaacaatccctccacagaatgttatatgttacgacgaccctgacccttatctggttgtt
gctgctgacaagggaacagctactttttccgatattgccaatagtattgccaaggaacat
ggattttggctaggtgatgcttttgcttctggaggttctgccgggtacgatcataaaaaa
atgggtattacagcacgtggtgcgtgggaatctgtcaaaagacattttcgtgaacttgat
atcaatattcagcaacaagactttacggtagtaggtattggtgatatgagtggtgatgta
tttggcaatggcatgctttattcaaaacatatacggctgttagctgcttttgatcatcgt
catatttttctcgacccgaatcccgaccctgtaaaatcctatgaagaaagacttcgcctg
tttaatttacctacttcatcctgggaagattacaacttacaacttatttctaaaggcgga
ggcgtttacaaacgctcaagcaaatcgatccccattagcccgcaagtaaaaaaagctctc
gctatagatgcaaatgcccttacgcccaatgagcttattcgagcgctgttaaaagcacca
gtggatttactgtttaacggcggtattggaacctatgtcaaagcaaccacggagtcacat
gccgatgttggcgacaagactaatgaattctgccgtattaatggcgcagaattacactgc
aaggtagtgggagaaggaggaaatctgggttttactcaacttggacgcgtcgagtttgca
ttaaagggcggtcttattaacactgatgcgattgataattccgccggcgttaactgctct
gaccatgaagtcaatatcaaaattcttttagataaagagattagagaaaagaaactcaca
gaaaaaaaacgcaatcaattgctaagcagaatgacagacgaagtcgccgatcttgttttg
caagacaactacaatcaagccttgattttaagtatatcggcagctcattcttctcattat
agtggcttatatcaagattacatgaaagaattggaaaagtgggttaaccttgacagaagc
gttgaattccttcctgacgataaaaaactcctcgaacgcaaaagcactggcgcagggctg
acaagaccagagcttgctgttttaatggcacacaccaaaattcatattgctaacgaatta
ttaaaatcgcatttacccgatgactcatacttcacaacttttttggaaacaggttttccc
atctcgctacgaaagccctatgcgaaagccttgccaaaacaccctttgtctcgtgaaatc
atagcgacgcaactgagcaataagctggttaacaacatgggaattaccttcatgtaccgc
atgctgatggaaaccggtatgtcgattgctgatattgcctgcgcttacactatttcagcc
tgtattttccaaacggatgtcttacaaaatctgattgattcatttcaagataaaatatcc
ttatccacccaatatgaattattgcatcacattcgccaattgctcaacttggcgacacgc
tggtttttgcataataatcgactgaccggaggcattgaaaaaaatattaaaaattatggc
aagtcagtcaaaaaacttgaactgttgattcccaagctcatgggtggtgtcactaaagaa
taccttgagaaactcattagccaattcgtcagtattggtattgaaaaggatatggctcaa
aaaattgctataactcgggctctttatacttcattaaatatcattgaagtagccacgcaa
aatgaatttgatttatcgcttactgcagaaacttactttaaagttggtagtcaatttaat
ctcgtttggtttcgcgaccaaatagccaatgactcacgtgaagggcattggaataccatg
gctcgcctgtctttgcgtgatgagttagataatctgcaaagacgtttgactattgccatt
ttaacaactaacaccaaagaacgtacttctgaaaaattgataaactattggctggaacaa
aatcaccccattcaaaaacgctgggaaaagttattagaaatgttattgggtagcgaaaac
atagattacaccatattttttatcgccttgcgtgagctttcctctttaattcaagtattg
taa

DBGET integrated database retrieval system