KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0525Help
Entry
LP6_0525          CDS       T02689                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase, E1 component (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LP6_0525 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LP6_0525 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    LP6_0525 (sucA)
   00380 Tryptophan metabolism
    LP6_0525 (sucA)
Enzymes [BR:lpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     LP6_0525 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
567846..570662
Genome map
AA seq 938 aa AA seqDB search
MIMSSSDLQKEWASSYLSGGSMAYVDSLYEDYLADPDSVSEDWRAVFSALPKVNGATKEV
SHRDIREYFLQHADKKLNKIIQIADSQQYQVASLINDFRSLGHLAAKLDPLEMTERMPVP
RLELAYHNLADVDVNRTFFAGTSFNGPEMTLGEIYNALRETYCRSIGIEYMHISDTEVTE
WLQNKMESVRGCPEFSPQEKLNILKDLIAADGLERYLGTRYVGQKRFSLEGGDSLIPMMK
ELIRRSGINNVKELVIGMAHRGRLNVLVNVLGKEPGLLFQEFEGKIKYERTGDVKYHLGF
SSDIKTESGAIVHLALAFNPSHLEIIGPVVEGSVRSRLGRRNDLAKKDKVVPIVIHGDAA
FAGQGVVMETFNFSQARGYCTGGTIHIVINNQIGFTTSNPLDARSTLYCTDVAKMVQAPV
IHVNGDDPEAVVFATQVAFDFRMKFKRDIVIDLVCYRRHGHNEADEPSVTQPKMYKKIKS
MPTLREKYGEQLVSANLLTKSEVDKLVDSYRETLDKGKAVVDLVHEDYEGKQSLDWTPYI
NAKWTDKVDTTISKEELEKISSQLNKLPDGMKLHPVVERLLAERNKMTAGEIPMNWGYAE
IMAYASLLHEGYGVRISGQDSGRGTFAHRHAVLHDIETGDTFIPLEHISTSPKRYFTVID
SVLSEEAVLAFEYGFASSEPSFLVIWEAQFGDFANGAQVVIDQFISSGEQKWGRLCGLVM
LLPHGYEGQGPEHSSARLERYMQLCAQHNIQVCTPTTPAQIFHLLRRQVIRNFRKPLIVM
TPKSLLRHKLAVSPLEALFKGKFHTVIPEIDALDAQKVTKVVLCCGKVYYDLLQMRRDKN
LNHVAIVRIEQLYPFPKKALMAELEKYQKANEVVWCQEEPQNQGVWFSSQHNMRDCLRSD
QTLQYAGREFAAAPAVGSPGLHAEQQVALVEQALLGKK
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgataatgagcagttctgatctgcaaaaagaatgggcttcttcctatttgtctggagga
agtatggcttatgttgatagtctttatgaggattacctcgcagaccctgattcagtgtca
gaggattggagagcggtatttagcgctttacccaaagtaaatggtgctaccaaagaagta
tctcatagggacattcgcgaatattttttgcagcatgctgataagaagcttaataaaata
attcaaattgcagacagtcagcagtaccaggttgccagtctgattaatgattttagatca
ttaggacatcttgccgcaaagctagatccattggaaatgacggagcgtatgccagtgcca
cggctggagcttgcttatcataatcttgccgatgtagatgtaaatcgtaccttttttgct
ggcaccagttttaatgggccagagatgaccttgggggaaatatacaacgcccttcgcgaa
acatactgccgcagtataggcatagaatatatgcatatctctgatacggaagtcactgaa
tggttacaaaacaaaatggaatcagtacgcggatgtcctgaattcagtccacaggaaaaa
ttgaatatccttaaagacttgatagcggcagacggtttggagcgttatctcggaacccga
tatgttggtcaaaagcgattttctcttgaggggggagattctttaattccaatgatgaaa
gaactcattagaagatcgggtataaacaatgtgaaagagcttgtcattggaatggcacac
agagggcgcctaaatgtattggtgaatgtccttggtaaagagccaggactattatttcaa
gaatttgaaggaaaaattaaatacgagcgaactggtgatgtgaagtatcatctgggtttt
tcctctgacataaaaacagaatcaggcgctattgtgcacttggctttggcatttaaccct
tcccacttggaaattatagggccagtagttgaaggatctgtacgttcacgtttgggaaga
cgcaacgatttggctaaaaaggataaagtagttcccattgtcattcatggcgatgccgct
tttgcaggtcagggtgtggttatggaaacctttaatttctcccaggcgcgtggatattgt
actggtggaacaatccatattgttatcaacaatcagataggatttacaacgagcaatcct
ttggatgcccgttcaactctctattgtacagatgttgccaaaatggttcaggcaccagtc
attcatgtcaatggagatgatcctgaggcagtagtttttgctacccaggttgcttttgat
ttccgaatgaagtttaagcgagacatagtaattgacttggtctgttacagacgtcatggc
cataatgaagcggatgaaccttctgtgactcagccaaagatgtataaaaaaatcaaatcc
atgcccacattacgtgaaaaatatggggaacaattggtcagcgctaatttattaaccaaa
tcagaagtagacaagttagttgattcctacagagaaacattggataagggtaaagcggtt
gtcgatttggttcatgaagattatgaaggaaagcaatctttagattggactccttatata
aatgccaagtggacggataaagtagacacaaccattagcaaggaagaattggaaaaaatt
tcatcccaattaaacaaattgcctgatggaatgaaactgcatcccgttgtggagcgtttg
ttagctgaacgaaataaaatgaccgctggtgaaatccctatgaattggggctatgccgag
atcatggcttatgccagtttgttacatgaaggctacggagtaagaatttctgggcaagat
agtggtcgaggaacttttgcccatagacatgccgtactccacgatattgaaacaggcgat
acttttattcctttggaacatatctcaaccagtcccaaacgttattttactgtaatagat
tcagtgctttctgaagaagcggtattagcttttgaatatggctttgcttcgtctgagcca
tctttcctggttatttgggaagctcaatttggtgattttgcaaatggagcacaagttgtt
atcgatcaatttataagttccggtgagcaaaagtgggggcggctgtgcggattggtgatg
cttttaccccatggctatgaaggacaaggccctgagcactcttctgcccgattggagcgt
tatatgcagctttgtgcacagcacaatattcaagtatgcactccaacaactccagcacaa
atatttcatttgttaagaagacaagttattcgtaatttcaggaagcctttaattgtcatg
actcccaaaagtcttttacgacataaattggctgtttcacctttggaagctttgtttaaa
ggaaaatttcacacagtgattccggaaatcgatgccttggacgcacaaaaagtaacaaag
gtggtgttatgctgtggtaaggtttattatgatttattgcaaatgcgccgcgataaaaac
ttaaaccacgtagcgattgtccgtatagagcaattgtatccatttcccaaaaaagcatta
atggctgaattggagaaatatcaaaaggctaatgaagttgtctggtgtcaggaagagcca
caaaaccaaggagtctggttctcttctcagcataatatgcgtgattgcttgcgttctgac
caaaccttgcaatatgctggcagagagtttgctgctgcacctgcagttggtagtcccggg
ttgcatgcggagcaacaagttgctttggttgagcaagcattacttggtaaaaaataa

DBGET integrated database retrieval system