KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0525Help
Entry
LP6_0525          CDS       T02689                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
lpm00020  Citrate cycle (TCA cycle)
lpm00310  Lysine degradation
lpm00380  Tryptophan metabolism
lpm01100  Metabolic pathways
lpm01110  Biosynthesis of secondary metabolites
lpm01120  Microbial metabolism in diverse environments
lpm01130  Biosynthesis of antibiotics
lpm01200  Carbon metabolism
Module
lpm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LP6_0525 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    LP6_0525 (sucA)
   00380 Tryptophan metabolism
    LP6_0525 (sucA)
Enzymes [BR:lpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     LP6_0525 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II cwf21
Motif
Other DBs
NCBI-ProteinID: AGN13446
Position
567846..570662
Genome map
AA seq 938 aa AA seqDB search
MIMSSSDLQKEWASSYLSGGSMAYVDSLYEDYLADPDSVSEDWRAVFSALPKVNGATKEV
SHRDIREYFLQHADKKLNKIIQIADSQQYQVASLINDFRSLGHLAAKLDPLEMTERMPVP
RLELAYHNLADVDVNRTFFAGTSFNGPEMTLGEIYNALRETYCRSIGIEYMHISDTEVTE
WLQNKMESVRGCPEFSPQEKLNILKDLIAADGLERYLGTRYVGQKRFSLEGGDSLIPMMK
ELIRRSGINNVKELVIGMAHRGRLNVLVNVLGKEPGLLFQEFEGKIKYERTGDVKYHLGF
SSDIKTESGAIVHLALAFNPSHLEIIGPVVEGSVRSRLGRRNDLAKKDKVVPIVIHGDAA
FAGQGVVMETFNFSQARGYCTGGTIHIVINNQIGFTTSNPLDARSTLYCTDVAKMVQAPV
IHVNGDDPEAVVFATQVAFDFRMKFKRDIVIDLVCYRRHGHNEADEPSVTQPKMYKKIKS
MPTLREKYGEQLVSANLLTKSEVDKLVDSYRETLDKGKAVVDLVHEDYEGKQSLDWTPYI
NAKWTDKVDTTISKEELEKISSQLNKLPDGMKLHPVVERLLAERNKMTAGEIPMNWGYAE
IMAYASLLHEGYGVRISGQDSGRGTFAHRHAVLHDIETGDTFIPLEHISTSPKRYFTVID
SVLSEEAVLAFEYGFASSEPSFLVIWEAQFGDFANGAQVVIDQFISSGEQKWGRLCGLVM
LLPHGYEGQGPEHSSARLERYMQLCAQHNIQVCTPTTPAQIFHLLRRQVIRNFRKPLIVM
TPKSLLRHKLAVSPLEALFKGKFHTVIPEIDALDAQKVTKVVLCCGKVYYDLLQMRRDKN
LNHVAIVRIEQLYPFPKKALMAELEKYQKANEVVWCQEEPQNQGVWFSSQHNMRDCLRSD
QTLQYAGREFAAAPAVGSPGLHAEQQVALVEQALLGKK
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgataatgagcagttctgatctgcaaaaagaatgggcttcttcctatttgtctggagga
agtatggcttatgttgatagtctttatgaggattacctcgcagaccctgattcagtgtca
gaggattggagagcggtatttagcgctttacccaaagtaaatggtgctaccaaagaagta
tctcatagggacattcgcgaatattttttgcagcatgctgataagaagcttaataaaata
attcaaattgcagacagtcagcagtaccaggttgccagtctgattaatgattttagatca
ttaggacatcttgccgcaaagctagatccattggaaatgacggagcgtatgccagtgcca
cggctggagcttgcttatcataatcttgccgatgtagatgtaaatcgtaccttttttgct
ggcaccagttttaatgggccagagatgaccttgggggaaatatacaacgcccttcgcgaa
acatactgccgcagtataggcatagaatatatgcatatctctgatacggaagtcactgaa
tggttacaaaacaaaatggaatcagtacgcggatgtcctgaattcagtccacaggaaaaa
ttgaatatccttaaagacttgatagcggcagacggtttggagcgttatctcggaacccga
tatgttggtcaaaagcgattttctcttgaggggggagattctttaattccaatgatgaaa
gaactcattagaagatcgggtataaacaatgtgaaagagcttgtcattggaatggcacac
agagggcgcctaaatgtattggtgaatgtccttggtaaagagccaggactattatttcaa
gaatttgaaggaaaaattaaatacgagcgaactggtgatgtgaagtatcatctgggtttt
tcctctgacataaaaacagaatcaggcgctattgtgcacttggctttggcatttaaccct
tcccacttggaaattatagggccagtagttgaaggatctgtacgttcacgtttgggaaga
cgcaacgatttggctaaaaaggataaagtagttcccattgtcattcatggcgatgccgct
tttgcaggtcagggtgtggttatggaaacctttaatttctcccaggcgcgtggatattgt
actggtggaacaatccatattgttatcaacaatcagataggatttacaacgagcaatcct
ttggatgcccgttcaactctctattgtacagatgttgccaaaatggttcaggcaccagtc
attcatgtcaatggagatgatcctgaggcagtagtttttgctacccaggttgcttttgat
ttccgaatgaagtttaagcgagacatagtaattgacttggtctgttacagacgtcatggc
cataatgaagcggatgaaccttctgtgactcagccaaagatgtataaaaaaatcaaatcc
atgcccacattacgtgaaaaatatggggaacaattggtcagcgctaatttattaaccaaa
tcagaagtagacaagttagttgattcctacagagaaacattggataagggtaaagcggtt
gtcgatttggttcatgaagattatgaaggaaagcaatctttagattggactccttatata
aatgccaagtggacggataaagtagacacaaccattagcaaggaagaattggaaaaaatt
tcatcccaattaaacaaattgcctgatggaatgaaactgcatcccgttgtggagcgtttg
ttagctgaacgaaataaaatgaccgctggtgaaatccctatgaattggggctatgccgag
atcatggcttatgccagtttgttacatgaaggctacggagtaagaatttctgggcaagat
agtggtcgaggaacttttgcccatagacatgccgtactccacgatattgaaacaggcgat
acttttattcctttggaacatatctcaaccagtcccaaacgttattttactgtaatagat
tcagtgctttctgaagaagcggtattagcttttgaatatggctttgcttcgtctgagcca
tctttcctggttatttgggaagctcaatttggtgattttgcaaatggagcacaagttgtt
atcgatcaatttataagttccggtgagcaaaagtgggggcggctgtgcggattggtgatg
cttttaccccatggctatgaaggacaaggccctgagcactcttctgcccgattggagcgt
tatatgcagctttgtgcacagcacaatattcaagtatgcactccaacaactccagcacaa
atatttcatttgttaagaagacaagttattcgtaatttcaggaagcctttaattgtcatg
actcccaaaagtcttttacgacataaattggctgtttcacctttggaagctttgtttaaa
ggaaaatttcacacagtgattccggaaatcgatgccttggacgcacaaaaagtaacaaag
gtggtgttatgctgtggtaaggtttattatgatttattgcaaatgcgccgcgataaaaac
ttaaaccacgtagcgattgtccgtatagagcaattgtatccatttcccaaaaaagcatta
atggctgaattggagaaatatcaaaaggctaatgaagttgtctggtgtcaggaagagcca
caaaaccaaggagtctggttctcttctcagcataatatgcgtgattgcttgcgttctgac
caaaccttgcaatatgctggcagagagtttgctgctgcacctgcagttggtagtcccggg
ttgcatgcggagcaacaagttgctttggttgagcaagcattacttggtaaaaaataa

DBGET integrated database retrieval system