KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0549Help
Entry
LP6_0549          CDS       T02689                                 

Gene name
oLE1
Definition
stearoyl-CoA-9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lpm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LP6_0549 (oLE1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LP6_0549 (oLE1)
Enzymes [BR:lpm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LP6_0549 (oLE1)
Lipid biosynthesis proteins [BR:lpm01004]
 Desaturase
  First
   LP6_0549 (oLE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
593325..594512
Genome map
AA seq 395 aa AA seqDB search
MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHPVVSHFFRFWLWLTTG
MVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYREARKDRDMVAKYSHGTP
TDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWIPLFAAGVINGIGHYWGY
RNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWWEFDIGWMYIRILSLFGLA
KVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSNYYKNVIRPILKYEKNTGIETKEDK
KLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYSYKQSLQNVWLKTATTQKELV
EALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtattcggctttttaaacctatctttctggggatatgttcttgcaacttttatcctg
actcaaatcacaattgcatctgttactatctatctgcataggaaccagactcatagagcg
ctaacattacaccctgtggtcagtcattttttccgtttttggttatggttaactacgggt
atggttactgcggattgggttgctatccatcgcaagcaccatgcaacaactgatgttgag
ggagaccctcatagcccagtggttgagggaatcaggaaggtattttggcaaggcgctgaa
ctttacagagaggcacgcaaggacagggatatggttgccaaatattctcatggcacgcca
accgattggatagagcgtaatgtctactcgcgccattcaagtaaaggtattttgctgatg
ttattactggatttatttttcttcgggattcctggaatgactgtatgggcaatccaaatg
atgtggattccgctgtttgctgcgggagtcatcaatggcatcggccattattggggatac
aggaattttgaatgtcctgatgctgctactaatatcattccctggggattttggattggt
ggagaagagttacataataatcatcacacttttgcgtcctcagccaaattttcagtgaaa
tggtgggagtttgatattggttggatgtatattcgcattctttccttgttcggtttggcc
aaggtaaaaaaattacctcccaaattggctatggatgaaggaaaattccatgttgatctg
gatactgtgagagcagttatttcaaatcgttttcaagtgatgtctaattactataagaat
gtcatcagacctattttgaagtatgaaaaaaataccggcattgagacaaaagaagacaag
aaattgtttcaacgggcaggtagattactgcgtcgagaggataagctattatcgacaaaa
gctaaaactcgtttgcaaaaactgctcgatgcccgcgaacagttgagagtggtttactct
tacaagcaatcattacaaaatgtttggctgaaaacagcaacgactcaaaaagaattagta
gaagctctgcagcaatggtgccgccaggcagaggaatcgggtcttgatgtgctgaaacag
tttgctcaacaattgaaaggctacgtaccggtatataccagggagtga

DBGET integrated database retrieval system