KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_0997Help
Entry
LP6_0997          CDS       T02689                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LP6_0997 (deoA)
Enzymes [BR:lpm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     LP6_0997 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1112341..1113858
Genome map
AA seq 505 aa AA seqDB search
MVSKQTSHGLRLKHLGIKTYHEAIIYMREDCHVCHSEGFEVQTRIQVTLGRRSIIATLNV
VTSELLQPGEAGLSDYAWDSLYAKEGDEIQVSHPKPLESLSYVHTKIYGNELSFEQMKVI
IDDVLSGRLSDVQISAFLAASSAGRLTRTEIMKLTKAMIDSGDRLSWSSPLVVDKHCVGG
LPGNRTTLIVVPIVAAFGLMIPKTSSRAITSPAGTADTMETLAPVHLSPQKMRQVVEQEN
GCIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVASILSKKIATGATHAVIDIPVGPTAK
VRNQSMAFLLKQLLEEVGNELGLVVHTILTDGSQPVGHGIGPSLEARDVMAVLQGLPDAP
NDLRERALTLAGAALEYSSKVQPGLGKSIAKQLLESGQAFKKFQAICEAQGGMRELTKAR
FTHPVVAAKAGKVSLIDNRKLAKIAKLAGAPKSKSAGIDLHVHLNKSVEKGEPLFTIHSE
SSGELNYACDLLRDKQDIIILGENS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagtaagcaaacctctcatgggcttcggttaaaacatttagggattaaaacctat
cacgaagctattatttacatgcgcgaggattgtcatgtttgtcattcggaaggattcgaa
gtacagacccgtatccaagtgactttaggtcggcgctctattatagccactcttaatgtg
gtgacctcagagctacttcagcctggtgaggctggtttgtcagattatgcctgggattct
ttatacgccaaagaaggcgatgaaattcaggtctcccatccaaaacccttggaatcctta
agttatgtgcataccaagatttatggcaatgagctgtcttttgagcaaatgaaggtcatc
attgatgatgtgttaagtggtcggctttctgatgtacaaatctccgcttttctagcggca
agtagcgcagggcgtctaacccgtacggaaatcatgaaactcaccaaagccatgatagac
agtggtgatcgcttatcctggtcttcacctctggtcgtcgataaacattgcgtgggagga
ttgccgggaaatcgcacgactctgattgtagttcccattgtggccgcttttggattgatg
attccaaaaacatcatcgcgtgccattacatcacccgcggggactgcggataccatggag
actttagctccagtccacttaagtccccaaaagatgcgccaagtggttgaacaagaaaac
ggctgtatcgtatggggtggggctgtgagtttaagtcctgctgatgacgtgctcatccgt
gtggaacgagccattgatttagatagtgaagggcaattagtggcttctattctttctaaa
aaaattgcaacaggtgccacacatgcggttattgatatcccagtaggacctactgccaaa
gttaggaatcagtctatggctttccttcttaaacaattgcttgaggaggtaggtaacgag
ttagggttggttgtccatacgatattgaccgatgggtcacaaccggtaggacatggcatt
ggcccatcgttagaagctcgcgatgtaatggcagtattacaagggttgcctgatgccccc
aatgatttgcgtgaacgggcgctgacgcttgcgggtgctgcgttagagtattcttcgaaa
gttcaaccgggtttaggcaaatccattgcgaagcaattattggagagtggacaagcgttt
aagaaatttcaggccatttgtgaggcccagggtgggatgagggaattgaccaaggcacgt
tttactcatcctgttgtggctgcaaaggcaggaaaagtctccctcattgacaatcgaaag
cttgcaaaaatagctaagcttgctggtgcgccaaaatcgaaatcggcgggtattgacctc
catgttcatttgaataaatccgttgaaaaaggcgagcctttgtttacaattcattcggag
tcttcaggggagctcaattacgcctgtgatttacttcgcgacaaacaagatatcattatt
ttaggagaaaactcttga

DBGET integrated database retrieval system