KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_1650Help
Entry
LP6_1650          CDS       T02689                                 

Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LP6_1650
Enzymes [BR:lpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LP6_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1863209..1865326
Genome map
AA seq 705 aa AA seqDB search
MGYHFLTEGNGIIACYDMYPTQFHSIKDMINYLPVLKQMGFNALWINPMQMPGDISGFFK
TDKNNGVKTGNEVTRSLYAMSHPLLFNPQFSLGSPEDPMGTTQRLNSEALQLFTQNARNL
GIVPMFDLVLNHVAIDSPLCQDKPHWFKGVHEDFKDVRGFNYDDESIRKEIITEFWQPYI
KRYMIEYGFDGVRVDAVGYVHPAVRSEIYAYIHSLAAEYGKPKPVILDEALFSKRPLADE
VNYLKLPGIGPTHITTEAYNVEFDLASADLPYEITLEEQLKASVVFQQKDGTWRENTKGG
CINFCGNHDYRSLAMTILFQMAKKRLESDAFYNDLMSSYQDLYFKFNAEQEKPHELKEPL
KTTLLYSYVDQIKKELEDNKDETTQEFKTLVLEKLALSALTASGGWFLLSGDETCDITAK
TVFQRKGAVDKSYYPQREHRIFSEKPVIAHKILEKMAEENFFIENSENKWMQELYRSLSS
FPEMQKRLLVSHIDNIKHQINAGIDHVQEKFSRLLASENLNIGFTSQDFLENPRTHENGW
LGLQNNFLFIKQLNTLLKRLPASLPGFSSELVRLPEKPHLIIIVRKNGNELNAPIDVVVV
NLEQEKRQTLTKEDFQLIAKNYCNQYFSKNRPSVCDSLREKLYSHVLKSAVNNRVHTDTS
IKLNGIHLFEFKETSLNTFFTIEKEKNYSHGNEDNTALTGNTISH
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggatatcattttttaacagaaggaaatgggattattgcatgttatgacatgtaccca
actcagtttcattctattaaggacatgattaattatttgcctgtcttaaagcagatgggg
tttaatgccttatggattaatcccatgcaaatgcccggtgacattagcggcttttttaaa
acggataaaaataatggtgtaaaaacaggaaatgaggtcactagaagcttatatgccatg
agtcacccgttattatttaatcctcaattcagtttgggctcccctgaagaccccatgggg
acaacccaacgattaaactcagaagctttacagttattcactcaaaatgcaaggaacctc
ggaatagttccaatgtttgatctggttttaaatcatgtcgccattgattctcccttgtgt
caggataagcctcattggttcaaaggagttcatgaagacttcaaagatgttcgcggcttc
aattacgatgatgaaagcataagaaaagaaataataaccgaattttggcaaccttatatc
aaacgttacatgatcgagtacggttttgatggtgttcgagtcgatgctgtaggttatgta
catcctgcagtaagaagtgaaatatatgcctatattcactctcttgctgctgaatatggt
aaaccaaagccggttatccttgatgaagctttatttagtaaacgaccacttgcggatgaa
gtaaattatttgaaattacccggcataggcccaactcacatcactacagaagcttataat
gttgaatttgatcttgccagcgctgatctgccttatgaaataacattggaagagcagtta
aaggcgagtgtagtcttccaacaaaaagatggaacatggcgtgaaaacacgaaggggggc
tgcattaatttttgtgggaatcatgactatcgctcattggcgatgactattttatttcaa
atggccaaaaaaagactggaatctgacgctttttataatgacttaatgtcttcctatcaa
gacttgtactttaagtttaacgccgagcaagaaaaaccacatgaactcaaggagcctttg
aaaacaaccttactttactcttatgttgatcaaatcaaaaaggagttggaagataataaa
gatgaaacaacacaagaatttaaaactctggtattagaaaaactggctttatccgctctt
acagccagtggcggatggtttttattatctggtgatgaaacatgcgatatcactgcaaaa
acagtatttcagagaaaaggtgctgttgataaatcttattacccacaacgtgaacatcgt
atttttagtgaaaaaccagttattgctcacaaaattttagaaaaaatggcagaagagaat
ttcttcatagaaaactcggaaaataagtggatgcaggaactttacagaagtttatcaagt
tttcctgaaatgcaaaaacgtcttttagtatctcatattgataatattaaacaccaaata
aatgccggcatagatcatgtacaagaaaaattttccaggctacttgccagtgaaaattta
aatataggtttcacatctcaagattttttagagaatccaagaacccacgaaaatggatgg
cttggattacagaataattttctatttatcaaacaattaaatacattattaaaaagacta
cctgcatcactacccggattctccagtgagttggttcgactccctgaaaaaccgcatctc
attattatcgtaagaaaaaatggtaatgaattaaatgctccaattgatgttgttgttgtt
aaccttgaacaggaaaaacgacaaacattaactaaagaagattttcaattaattgccaaa
aactattgtaatcaatatttttctaaaaatagaccgagtgtttgcgatagtttacgcgaa
aaattatattcccatgttttaaaatctgctgtaaataatcgagtccatacagacaccagt
attaaactgaatggaatccatttatttgagtttaaagaaacttcgttaaacacttttttt
acaattgaaaaagaaaaaaactattctcatggaaatgaagacaatactgctttgactgga
aatacaatctcgcattag

DBGET integrated database retrieval system