KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_2874Help
Entry
LP6_2874          CDS       T02689                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Brite
Enzymes [BR:lpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LP6_2874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3275193..3276002
Genome map
AA seq 269 aa AA seqDB search
MTMKNEYSMKINDFRYMRRGKHLSELQSEEANLLAPVNQRGKGTERALLVLHGFSSSPAV
YRYLIPNLKNYDAILCPVLAGHAESIEAFSKSKAADWLQSAKSACELLINQYQKVDVLGL
SLGGLLACQLSQSYAINHLFLLAPALKLHMRINAMLKLAQILKCLGFRQLRNAAGNIITD
EHAEIAYRKLPISTIIEMLTLAQGYEWLPPTCPADLFLGIHDQVVASQQVEQLFCNLPNV
KIHWLKNSAHVLPLDNDLNEIIDCINKSK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaaaaatgaatattctatgaaaatcaatgattttcggtatatgcgccgcggc
aaacatctcagcgaactgcagtcggaggaagcaaatctccttgctccagtcaatcagcgt
ggtaaaggcacagaacgagctttactggtattgcatggtttctcttcttcaccggcagtt
taccgatatctgattcctaatttaaaaaattatgatgccatcctttgtcctgtattggct
ggtcacgccgaaagtatagaagccttttcaaaatccaaagcagctgattggcttcaatca
gcaaaaagcgcctgtgaactcttaataaatcagtatcaaaaagttgatgttttaggatta
tccctgggaggattattagcctgtcaattaagtcaatcctatgctatcaatcacctgttt
ctattagcccccgcattaaaattacacatgcgcatcaacgccatgctgaaattagcccag
attcttaagtgcctcggatttcgacaacttcgcaacgctgcagggaatattatcaccgat
gagcatgccgaaatcgcttatagaaaacttcccatttccacaatcattgaaatgctaacc
ttggctcagggatatgaatggctccccccaacttgcccggccgatctttttcttggaatt
catgatcaagtggttgcttctcaacaagtagaacaattattttgtaatttacctaatgtc
aaaatacattggctaaaaaattccgcgcatgtactgccgctagacaacgatctgaatgag
attattgattgtattaataaaagcaaatga

DBGET integrated database retrieval system