KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg0419Help
Entry
lpg0419           CDS       T00199                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
lpn00010  Glycolysis / Gluconeogenesis
lpn00052  Galactose metabolism
lpn00500  Starch and sucrose metabolism
lpn00520  Amino sugar and nucleotide sugar metabolism
lpn00521  Streptomycin biosynthesis
lpn01100  Metabolic pathways
lpn01110  Biosynthesis of secondary metabolites
lpn01120  Microbial metabolism in diverse environments
lpn01130  Biosynthesis of antibiotics
lpn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpg0419 (glk)
   00052 Galactose metabolism
    lpg0419 (glk)
   00500 Starch and sucrose metabolism
    lpg0419 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    lpg0419 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lpg0419 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    lpg0419 (glk)
Enzymes [BR:lpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lpg0419 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-GeneID: 19831985
NCBI-ProteinID: YP_094463
Pasteur: lpg0419
UniProt: Q5ZYF3
Position
459147..460154
Genome map
AA seq 335 aa AA seqDB search
MNFFMMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCAEFISLESALLTYKNR
HSLQEIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEVLEVMNDFTAIAMSLPV
LSTQDLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSAFAGEGGHADWGAKTEQE
WFIYRYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEFLSAAQIISLALNQECFIA
HKAVAQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSLVHQSDFRIQFEDKGRFSDF
NALIPTYVIAAAQPGILGASVSLKQILTGASHVLF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttttatgatgcctcatgatttagcgcagtatgcgattgttgcggacataggc
ggtacttttgctcgtttcagtagagttaatcttgtcaatttgcagatggataaaattgaa
atttctccttgtgccgagtttattagtcttgagtccgcgctattaacttataaaaaccgg
cattctttgcaagaaataaaacatattgcgatagcgattgcgtgtccagtcatcgatgat
ttggtttctatgacgaattgtcattggcaattttcaataacagagttaaaacagagactt
ggtcttgaagttctggaagtcatgaatgattttactgcgattgcgatgagtttacctgta
ttatcgactcaggatctggtgcagattggtaatggttacctggatgccagtaaagtgaga
gtggtgttaggcgcaggaaccggtttgggtgttgcttatttaattcctcatcaacatcac
tatagtgcttttgcaggggaaggggggcatgctgattggggagcaaaaactgagcaggag
tggtttatctatcgttatttgaaaagtaaatactcccatgtatcttatgagcgattgctg
tctggacaaggactggaaaatttatatcaagctttagccgcgtatcatagtaaaaaagtt
gaatttttgtcagcagcacaaattatatctttggcattaaatcaggaatgtttcatagct
cataaggcagtagcccaatttttttcaagtttgggatcgtttgctggtgatttagcatta
acttatggagcttttggtggtgtttatattgcaggagggattatgccgcgtttactctct
ttggtacaccaaagcgactttagaatccaatttgaagacaaaggacgatttagtgatttt
aatgccttaattcctacttatgtcattgcagccgctcaaccaggtattttaggcgcgagc
gtcagtttaaaacaaatattgacaggagcttctcatgtccttttctga

DBGET integrated database retrieval system