KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg0422Help
Entry
lpg0422           CDS       T00199                                 

Gene name
legY
Definition
glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lpg0422 (legY)
Enzymes [BR:lpn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     lpg0422 (legY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(462427..463776)
Genome map
AA seq 449 aa AA seqDB search
MATFFFKTNYYQEIMLKRIFFLMIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVAS
PSQYNPNYYYDWIRDSAIAMGLVETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQD
ILGEPKFYINGNPFDGEWGRPQNDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDP
QSMGTIKMDLEYIAHHWQDANFDLWEEVYGHHFFTAMAQQKALTDGAILAHQLHDRQAAV
FYEMQANLINSRLKQHLDHQNKIIQATLLPHPGPQKTLELDSSVMLGILINPQKEGVFAP
HHTFVQNTAKALHEQFNLMFPINKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMA
EYYFTMAHNLSPNSINKLHIQNYLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSL
TWSYVSVLRAIHLREQLENRIKTTGWNTY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttcttttttaaaactaactactatcaggagattatgttgaaaaggatcttt
ttcttaatgattttttttgtctctcaaactatggcttcagtatttacccatgaagaggtt
caaatattaaaaaaacattttttaaataactttcaaaccaatggagccatcgtagcctca
ccctcgcaatacaaccccaattattattatgactggattcgagactcagccattgccatg
ggattggttgaaacatggtatgaagccagccaatctgctcgatataaaaaacttttatta
gaatacgtttcatggacagaaaaaatacagcatcaagcggatcccattgctggccaggat
atattgggtgaacccaaattttatatcaatggcaatccttttgatggggaatggggacgg
ccacaaaatgatggtccggcactcagagcatctgttttaattcgttttgcgcaacagctt
ctcgatcataatgaaatagattatgttaaatcacatctttataacaacaccatggaccca
caatccatgggcactatcaagatggatttggaatacatcgcacatcattggcaagatgca
aattttgacctgtgggaagaggtttatggccatcattttttcacggctatggcacaacaa
aaagcgctgaccgatggcgccattttagctcaccaacttcatgacagacaagctgctgtt
ttttatgaaatgcaagccaacttaattaacagtcgactgaaacagcatttggaccatcag
aataaaataattcaagccacattattacctcaccccggtcctcaaaaaacactagagctt
gattcgtccgtcatgttgggtattttaattaacccacaaaaagaaggtgtttttgcccca
catcacacctttgtgcaaaatactgcaaaggctttgcatgagcaatttaatttgatgttt
cctattaataaaaaccgttctggagcaatattgtttggtcgttatcccggcgatacttat
gatggctaccaaacaaacagcatagggaacccctggtttatcttaaccgctacgatggct
gaatattattttaccatggctcataatctgtccccgaacagcattaataaacttcatata
cagaactatctaaagaaaggggacaattacctaaggctgataaaacaatatggccctgat
ctgaatttaagtgaacaaattaatttgaataccggagttcagcaaggagcgacatccttg
acctggagttacgtttccgtcttgcgagctattcatttaagagaacaattggaaaataga
ataaaaactacgggctggaatacctattag

DBGET integrated database retrieval system