KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg0529Help
Entry
lpg0529           CDS       T00199                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein subunit D (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpg0529 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpg0529 (sdhD)
   00650 Butanoate metabolism
    lpg0529 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    lpg0529 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
569526..569873
Genome map
AA seq 115 aa AA seqDB search
MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLSFSQWHLLFTNKAFQIA
TTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLTQFIWGLMIIWGQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtcaccagtttaacaggaaatgggttaaaggattggttaattcaacga
gttaccgctgtctattttgcagcctatttaatttttttgtttggatttatattggcaaat
cctgatttaagtttttctcaatggcatcttttgtttactaacaaggcatttcaaattgca
acaacaattggattgatggctttgacattgcatgcctggataggtatttggacagtaact
acagattatatgaaatgtactgttatacgtttatcagtgcagttattagttgttttgtgg
ctccttactcaatttatctggggccttatgatcatttggggacaatag

DBGET integrated database retrieval system