KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg0700Help
Entry
lpg0700           CDS       T00199                                 

Gene name
pcm
Definition
protein-L-isoaspartate-O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Brite
Enzymes [BR:lpn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     lpg0700 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(764716..765390)
Genome map
AA seq 224 aa AA seqDB search
MIIKTVEQMNHSARINMIKQQLRTGDVLNESILDLYDELLRHEFVPEPFSHFAYSDMQIP
LAYGQRMLTPLEEGTILQSLDLKGHETVLEVGTGTGFMTALLSKLCKKVISIDYYSEFTA
NAKRKLEEHNCNNVELITGDACRGWLESAPYDVIVFTGAMEKLTDTHKLQILPGGKLFAI
LGKSPVMQAYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattattaagacggtagagcaaatgaatcacagtgcacgcataaatatgatcaaacaa
cagttacgaactggtgatgtattaaacgaatccatccttgacttatacgatgagctctta
agacatgagtttgttcctgaacctttttctcattttgcttattcagacatgcaaattcct
ttggcatacggtcaaaggatgttaactccattggaagaaggtacaattttacaatccctt
gatcttaaaggtcatgaaactgtgttggaagtgggaacaggaaccggttttatgactgca
ttactcagtaagttatgtaaaaaagtcatcagtattgactattattctgaatttactgcc
aatgcaaaacgtaaactcgaggagcataattgtaataatgttgaattaattaccggagat
gcttgtcgtggatggttggaaagtgcgccatacgatgttatcgtattcactggtgccatg
gaaaaactgacagatacccataaactacaaattttacccggtggcaaattgttcgcaatc
cttggtaaatcccctgtaatgcaagcttatctttttcagttggatcataatgcaatctgg
acagaatccatgctttttgaaacggatatacctcctctggtagatcaattgaaaccgaaa
gaatttgttttctag

DBGET integrated database retrieval system