KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg0700Help
Entry
lpg0700           CDS       T00199                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate-O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Brite
Enzymes [BR:lpn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     lpg0700 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 RrnaAD Methyltransf_12 NodS Methyltransf_23 Methyltransf_18 MTS Methyltransf_4 Ubie_methyltran Methyltransf_PK CMAS GCD14 Methyltransf_2 PrmA Methyltransf_32 Methyltransf_3
Motif
Other DBs
NCBI-GeneID: 19832265
NCBI-ProteinID: YP_094736
Pasteur: lpg0700
UniProt: Q5ZXN1
Position
complement(764716..765390)
Genome map
AA seq 224 aa AA seqDB search
MIIKTVEQMNHSARINMIKQQLRTGDVLNESILDLYDELLRHEFVPEPFSHFAYSDMQIP
LAYGQRMLTPLEEGTILQSLDLKGHETVLEVGTGTGFMTALLSKLCKKVISIDYYSEFTA
NAKRKLEEHNCNNVELITGDACRGWLESAPYDVIVFTGAMEKLTDTHKLQILPGGKLFAI
LGKSPVMQAYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattattaagacggtagagcaaatgaatcacagtgcacgcataaatatgatcaaacaa
cagttacgaactggtgatgtattaaacgaatccatccttgacttatacgatgagctctta
agacatgagtttgttcctgaacctttttctcattttgcttattcagacatgcaaattcct
ttggcatacggtcaaaggatgttaactccattggaagaaggtacaattttacaatccctt
gatcttaaaggtcatgaaactgtgttggaagtgggaacaggaaccggttttatgactgca
ttactcagtaagttatgtaaaaaagtcatcagtattgactattattctgaatttactgcc
aatgcaaaacgtaaactcgaggagcataattgtaataatgttgaattaattaccggagat
gcttgtcgtggatggttggaaagtgcgccatacgatgttatcgtattcactggtgccatg
gaaaaactgacagatacccataaactacaaattttacccggtggcaaattgttcgcaatc
cttggtaaatcccctgtaatgcaagcttatctttttcagttggatcataatgcaatctgg
acagaatccatgctttttgaaacggatatacctcctctggtagatcaattgaaaccgaaa
gaatttgttttctag

DBGET integrated database retrieval system