KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg0756Help
Entry
lpg0756           CDS       T00199                                 

Definition
dTDP-6-deoxy-D-glucose-3,5-epimerase RmlC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    lpg0756
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lpg0756
Enzymes [BR:lpn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     lpg0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
827201..827764
Genome map
AA seq 187 aa AA seqDB search
MNIINTQIDELKIIEPKIYGDERGFFYESFQAKRYEELLGITDRFVQDNFSRSQKGVLRG
LHYQSQQTQGKLVSVLAGEVFDVAVDIRLGSPTFGQWVGVILSGENKRQFWIPKGFAHGF
YVLSAMADFAYKCTDYYHPESEFSIHYLDPQLAIDWPLGEQVQLSPKDAAAKLLNLIDAE
LLPRYQA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatataataaatactcagatcgatgaacttaaaattatcgaaccaaagatttatggt
gatgaaagggggtttttttatgaatcttttcaagctaaacgatatgaagagttattagga
ataactgatcgttttgtacaggataatttttcaagatcacaaaaaggtgtactaagaggt
ttgcattatcaaagtcaacaaactcagggaaaactggtttcagttttagctggtgaagtg
tttgatgttgccgtggatattaggttaggctcccctacttttgggcaatgggttggagtg
attctttccggagaaaacaaaaggcaattttggattcctaaaggatttgcccatgggttt
tatgttttgagtgctatggctgattttgcttataaatgtactgactattatcatcctgaa
agtgagttttccattcattatcttgatccgcaattagcaattgattggccattaggagag
caggttcaattgtctccaaaagatgctgcagccaagcttttaaatttaatagatgctgaa
cttttaccgagatatcaagcctaa

DBGET integrated database retrieval system