KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg0847Help
Entry
lpg0847           CDS       T00199                                 

Gene name
murA
Definition
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
lpn00520  Amino sugar and nucleotide sugar metabolism
lpn00550  Peptidoglycan biosynthesis
lpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    lpg0847 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lpg0847 (murA)
Enzymes [BR:lpn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     lpg0847 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:lpn01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   lpg0847 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-GeneID: 19832413
NCBI-ProteinID: YP_094882
Pasteur: lpg0847
UniProt: Q5ZX85
Position
923134..924402
Genome map
AA seq 422 aa AA seqDB search
MDKLLINGGKALHGEVVISGAKNAALPIMAASLLASDHVTISNVPHLKDITTMMELLGQL
GAHLIVDEKMNVQVDSSQVNEFVAPYDLVKTMRASILVLGPMLARFGKADVSLPGGCAIG
TRPVDLHLKALRAMGADITVKNGYINARCKKGCLQGKRLMFDTVTVTGTENVLMAAVLAE
GITTIKNAAREPEVVDLANFLIQMGAKIRGAGTSTIEVEGVESLNGGTYSVMSDRIEAGT
YLAAGALTRGQVTVKKVRPDTLLSQLCKFEEAGAELTIGEDWVSLNMHNKRPQAVNISTA
PYPAFATDMQAQFMAMNSVAEGSSTIIETIFENRFMHVQELQRMGANIQLNGNTAIVHGV
EKLTGAPVMATDLRASASLILAGLVAEGETVVERIYHVDRGYERIEEKLSLLGADIKRVS
DR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggataaattattgattaatggtggtaaagcattacatggtgaagtggtcatttcggga
gcaaaaaacgctgctcttccaatcatggctgccagtctattagccagtgatcacgtcaca
atatctaatgtgcctcatcttaaagacatcactaccatgatggaactgttaggacaattg
ggagctcatttaattgttgatgaaaagatgaatgttcaagttgactccagtcaagtcaat
gagtttgttgctccttacgatctggtcaaaacaatgcgtgcctccattttggtattaggc
ccaatgctggcgcgcttcggtaaggcagatgtttctctgcccggtggatgcgccattgga
acaagaccagttgacctgcatttaaaagcattaagagccatgggggcagacattacggtt
aaaaatggctacatcaatgctcgttgcaaaaagggatgtctgcaaggtaaacgcttgatg
tttgacacagttactgtcacaggaaccgaaaatgtgttaatggctgctgtgttggcagaa
ggcattactacgattaaaaatgctgcgcgcgaaccagaagtagtagacttggctaacttt
ctgattcaaatgggagcgaaaattcgaggcgcgggtacttctactattgaagtagaaggt
gtggaatcactaaacggtgggacttattcggtcatgtccgatagaatagaagcgggcact
tatttggcagctggagcgcttactcgtggtcaagtgactgttaagaaagtacgtcctgat
actttattatctcaattatgtaaattcgaagaggcaggcgcggaattaaccattggtgag
gattgggtcagtttaaatatgcataacaagcggcctcaggcagttaatatttcaaccgcc
ccttatcctgcatttgcaacggatatgcaagctcaatttatggcaatgaattccgtagca
gaaggttcttcaactattatagaaactatttttgaaaaccgatttatgcatgttcaagag
ttacagagaatgggggctaatatccaacttaatggaaatacagccatcgttcatggtgtt
gaaaaattaactggcgcaccggtaatggctactgatttaagggcatcagccagtttaatt
ctcgcgggcctggttgctgaaggggaaacagtagttgagcggatttatcatgttgataga
ggctatgagcgaatagaagaaaagttatctctattgggagcggacattaagagagtttct
gacaggtga

DBGET integrated database retrieval system