KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg0917Help
Entry
lpg0917           CDS       T00199                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetase MurE (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lpn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lpn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
990018..991469
Genome map
AA seq 483 aa AA seqDB search
MKLTQLLEPWIKRDIIDGTVSDIKNDSRLVKEGDLFVAYPGAASDGRLYIEKAVASGAVA
VVYEPNNLPQGITLPTGIPCIAIPQLAEKLGEIAKRFFNNPSQFLGLTGVTGTNGKTTIA
YQLAQAHDLLGQHSAYIGTIGQGKVDALKPLENTTPDALCLQRLMHQYKEGGIKQVCMEV
SSHALSQHRVDSLEFSQAIFTNLTLDHLDYHQTMQAYGAAKSRLFERAELQWAIINQDDD
FQDLMSNVLKTHVKKVTYGMHQNCDVKALQWNMDITGTEIEVKSPWGHHLLKIKALGKFN
IYNSLAVYSSLLASGYNPEKVVQVMAELKAAPGRMEIVAQSPYVLVDYAHTPDALENVLI
TLKQIKKGRLWVVFGCGGDRDKTKRPIMGKAASMYADNIVITSDNPRSEDPEIILNEIAC
GIPASAPVSKLVNREEAIAYALRKAEHNDIILIAGKGHESYQQIGNTKHVFSDQEVVRRL
MNN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaacccaattattagaaccgtggattaaaagggacattattgatggcactgtg
agtgacataaaaaatgacagccgcttggtgaaagaaggggatttatttgtcgcctatcca
ggggcagcttccgatggtcgattatatatagaaaaagccgtggcatcaggtgctgtcgct
gtggtttatgagcccaataatttacctcagggaattactttgccaacaggaattccctgt
atagccattccccaattagctgaaaaattaggggaaatagcgaaacggttttttaataac
ccatcccaatttcttggtttaactggggtaactggcacaaatggtaagacgactattgct
tatcagttggcacaggcacatgatttactcgggcagcactcggcttacatcgggactata
gggcaaggaaaggtggatgccttaaaacctttggaaaatactacgccagatgctctttgt
ttgcagaggttaatgcatcagtataaagaaggaggcattaaacaggtttgtatggaggta
tcctctcatgcgctgagccagcatagagtcgactctctcgaatttagtcaggctatcttt
accaatttaacgctcgatcatttagattatcaccagacaatgcaagcttatggggctgca
aagtcgaggttgtttgaacgagcagagttgcaatgggctattattaatcaggatgatgac
tttcaagatctcatgagcaatgtgctaaagactcatgtaaaaaaagtgacttacggtatg
catcaaaattgcgatgtgaaagcgctccaatggaatatggatatcaccggaacagaaatt
gaagtcaaatctccttgggggcaccaccttctaaagattaaagcactgggtaagtttaat
atttataatagcctggctgtttatagcagtttgcttgccagcgggtataatccagaaaaa
gtagtgcaagttatggccgaattaaaagcggctcctggccgaatggaaattgtcgctcaa
tccccatatgttcttgttgattatgctcatactcccgatgcattggaaaatgttcttatc
accttaaaacaaataaaaaaagggagattgtgggttgtatttggttgtggtggggacaga
gataaaaccaaacggcccattatgggaaaggcagccagcatgtacgctgataatattgtc
attaccagcgataatccaagaagtgaagatccggaaattattctaaatgaaattgcttgt
ggcattcctgcctctgcgcctgtctctaaactggtgaatagagaagaggcaattgcttat
gctttaagaaaggctgagcataacgatatcatattaatagcaggaaaaggacatgaatcg
tatcagcagattgggaatacaaaacatgttttttctgatcaggaagttgtaagacgtttg
atgaataattaa

DBGET integrated database retrieval system