KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1022Help
Entry
lpg1022           CDS       T00199                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lpn00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1119060..1120613
Genome map
AA seq 517 aa AA seqDB search
MHDSFLSANGGFVVSKKTPHGLRLKHLGIKTYHEAIIYMREDCHVCHSEGFEVQTRIQVT
LGSRSIIATLNVVTSELLQPGEAGLSDYAWESLHAKEGDEIQVSHPKPLESLSYVHAKIY
GNELSFEQMKVIIDDVLSGRLSDVQISAFLAASGAGRLTRTEVMKLTKAMIDSGDRLSWP
SPLVVDKHCVGGLPGNRTTLIVVPIVASFGLMIPKTSSRAITSPAGTADTMETLAPVHLS
PQKMRQVVEQENGCIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVASILSKKIATGATH
AVIDIPVGPTAKVRNQSMALLLKQSLEEVGNELGLVVRALFTDGSQPVGHGIGPSLEARD
VLAVLQGLPDAPNDLRERALTLAGAALECSSKVPPGLGKSIATQLLESGQAFKKFQAICE
AQGGMRELTKARFTYPVVAAKEGKVSLIDNRKLAKIAKLAGAPKSKSAGIDLHAHVGESV
EQGEPLFTIHSESLGELHYACDLLRDKQDIIILGENP
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
ttgcacgattccttcttatctgcaaacggaggatttgttgtgagtaagaaaacccctcat
gggcttcgtttaaagcatttagggattaaaacctatcatgaagccattatttacatgcgc
gaggattgccatgtctgtcactcggaaggatttgaagtacagacccgtatccaagtgact
ttaggtagccgctccattatagccaccctcaatgtggtgacctcagagctacttcagcct
ggtgaggctggtttgtcggattacgcctgggagtctttacatgccaaagaaggtgatgaa
attcaggtctctcatccaaaacccttggaatccttaagctatgtgcatgccaagatttat
ggcaatgaactgtcttttgagcaaatgaaagtgattattgatgatgtgttaagcggtcga
ctttctgatgtacaaatttccgcttttctagcggcaagtggcgcaggacgtctaacccgt
acggaagtgatgaagctcaccaaagctatgattgatagtggcgatcgtttatcttggcct
tcgcctctggtcgttgataaacattgcgtggggggattaccgggaaatcgcacgactctg
attgtagttcccattgtggcttcatttggattgatgattccaaaaacatcatcgcgtgct
attacatcccctgcgggaactgcagataccatggagactttagctccagtccacttaagt
ccccaaaagatgcgccaagtggttgaacaagaaaatggctgtattgtctggggtggggct
gtgagtttaagtcctgctgatgacgtgcttattcgtgtggaacgagccatagatttagat
agtgaagggcaattagtggcttccattctttctaaaaaaattgcaacaggggccacacac
gcggttattgatatccccgtaggacctactgccaaagtcaggaatcagtctatggcgctc
cttctgaaacaatcacttgaggaggtaggtaacgagttagggcttgttgtccgtgcgtta
tttacggatgggtcgcagccggtaggccatggcattggtccatcgttagaagctcgcgat
gtattggcagtattacaagggttgcctgatgcgcccaatgatttgcgtgaacgagcgttg
acgcttgcaggtgctgcgttagagtgttcttcgaaagtaccaccgggtttaggtaaatcc
attgcgacgcaattattggagagtgggcaagcgtttaagaaatttcaggccatttgtgag
gctcagggtgggatgagggaattgaccaaggcacgttttacttatcctgttgtggctgca
aaggaaggaaaagtctccctcattgacaatcgaaagcttgcaaaaatagctaagcttgct
ggtgcgccaaaatcgaaatcggcgggtattgacctccatgcccatgtcggcgaatccgtt
gaacaaggcgagcctttgtttacaattcattcggagtctttaggggagctccattacgcc
tgtgatttacttcgcgataaacaagacatcattattttaggagaaaacccttga

DBGET integrated database retrieval system