KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1288Help
Entry
lpg1288           CDS       T00199                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lpn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1415804..1416403
Genome map
AA seq 199 aa AA seqDB search
MIGWLHGQIIDKHQPGKLVLDVNGVGYDVETSLNTFFQIENGNQPVGLHIHTIVREDALL
LYGFLDKEERSLFRSLIKVNGVGPKLAMTVLSSISPKEFIQCIHQENAALLTKLPGIGKK
TAERLVVEMRDSIKQFDGSVSDTFQKQAGSTHSQQEAISALEALGYKPQEAWKVMNKIDN
GNKSCEQLIREALQILSSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgataggctggctccatggtcaaattatagataagcatcagccaggaaaattggttctt
gatgtcaatggcgtaggatatgatgtagaaacatctttgaatactttttttcagatagaa
aatggtaaccaacctgtcggattacatattcacaccatagttcgagaagatgctttgtta
ttgtatggcttcctggataaagaggagcgttctttattcagatcattaattaaagtgaat
ggggtaggccccaaactggctatgactgttttatccagtatttctcctaaggaatttatt
cagtgtattcaccaggagaatgctgctttattaaccaaattacctggcataggcaagaaa
actgcagagcgcttagtagttgaaatgagagacagtataaaacaatttgatggttcggtt
tccgataccttccaaaagcaggcaggtagcactcatagtcaacaagaggcaatcagcgcg
ttggaggcattaggctataagccacaagaggcgtggaaagttatgaataaaattgataat
ggcaataagagttgtgagcaattgattcgtgaggctttgcaaattctttcttcgcgatga

DBGET integrated database retrieval system