KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1288Help
Entry
lpg1288           CDS       T00199                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpg1288 (ruvA)
Enzymes [BR:lpn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     lpg1288 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1415804..1416403
Genome map
AA seq 199 aa AA seqDB search
MIGWLHGQIIDKHQPGKLVLDVNGVGYDVETSLNTFFQIENGNQPVGLHIHTIVREDALL
LYGFLDKEERSLFRSLIKVNGVGPKLAMTVLSSISPKEFIQCIHQENAALLTKLPGIGKK
TAERLVVEMRDSIKQFDGSVSDTFQKQAGSTHSQQEAISALEALGYKPQEAWKVMNKIDN
GNKSCEQLIREALQILSSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgataggctggctccatggtcaaattatagataagcatcagccaggaaaattggttctt
gatgtcaatggcgtaggatatgatgtagaaacatctttgaatactttttttcagatagaa
aatggtaaccaacctgtcggattacatattcacaccatagttcgagaagatgctttgtta
ttgtatggcttcctggataaagaggagcgttctttattcagatcattaattaaagtgaat
ggggtaggccccaaactggctatgactgttttatccagtatttctcctaaggaatttatt
cagtgtattcaccaggagaatgctgctttattaaccaaattacctggcataggcaagaaa
actgcagagcgcttagtagttgaaatgagagacagtataaaacaatttgatggttcggtt
tccgataccttccaaaagcaggcaggtagcactcatagtcaacaagaggcaatcagcgcg
ttggaggcattaggctataagccacaagaggcgtggaaagttatgaataaaattgataat
ggcaataagagttgtgagcaattgattcgtgaggctttgcaaattctttcttcgcgatga

DBGET integrated database retrieval system