KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1288Help
Entry
lpg1288           CDS       T00199                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpg1288 (ruvA)
Enzymes [BR:lpn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     lpg1288 (ruvA)
DNA repair and recombination proteins [BR:lpn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     lpg1288 (ruvA)
    RecFOR pathway proteins
     lpg1288 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1415804..1416403
Genome map
AA seq 199 aa AA seqDB search
MIGWLHGQIIDKHQPGKLVLDVNGVGYDVETSLNTFFQIENGNQPVGLHIHTIVREDALL
LYGFLDKEERSLFRSLIKVNGVGPKLAMTVLSSISPKEFIQCIHQENAALLTKLPGIGKK
TAERLVVEMRDSIKQFDGSVSDTFQKQAGSTHSQQEAISALEALGYKPQEAWKVMNKIDN
GNKSCEQLIREALQILSSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgataggctggctccatggtcaaattatagataagcatcagccaggaaaattggttctt
gatgtcaatggcgtaggatatgatgtagaaacatctttgaatactttttttcagatagaa
aatggtaaccaacctgtcggattacatattcacaccatagttcgagaagatgctttgtta
ttgtatggcttcctggataaagaggagcgttctttattcagatcattaattaaagtgaat
ggggtaggccccaaactggctatgactgttttatccagtatttctcctaaggaatttatt
cagtgtattcaccaggagaatgctgctttattaaccaaattacctggcataggcaagaaa
actgcagagcgcttagtagttgaaatgagagacagtataaaacaatttgatggttcggtt
tccgataccttccaaaagcaggcaggtagcactcatagtcaacaagaggcaatcagcgcg
ttggaggcattaggctataagccacaagaggcgtggaaagttatgaataaaattgataat
ggcaataagagttgtgagcaattgattcgtgaggctttgcaaattctttcttcgcgatga

DBGET integrated database retrieval system