KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1304Help
Entry
lpg1304           CDS       T00199                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lpg1304
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpg1304
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpg1304
Enzymes [BR:lpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lpg1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1432600..1433799
Genome map
AA seq 399 aa AA seqDB search
MIKKELPDEFGHFGPYGGMFVADTLVHALKQLEHAYTKYRNDQDFLSELHTELKDYVGRP
NPLYHAVHLSKKIGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQH
GVATATVAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSKTLKDALNEALR
DWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKTGHLPDALVACVGGGS
NAIGLFYPFLNDQSVMIYGVEAGGKGIETGEHSASLIAGKPGVLHGNRTYLLCDEYGQVK
DTHSVSAGLDYPGVGPEHAYLKDTGRVIYKAINDSEAMDAFRLLTHTEGIIPALESSHAV
AYAIQLAKTMSKEQSIIVNLSGRGDKDMHTVAAIDGITI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagagcttccagatgagtttggccattttggcccatatggcggtatgttt
gtagccgatacattagttcatgctttaaaacaattagagcatgcctataccaaatatcgt
aacgatcaggattttctgtctgagttacacacagaattaaaagattatgtggggcggccc
aatcctctataccatgccgtacacttaagcaaaaagataggcggtgcacaaatttatctc
aagcgtgaagatttaaatcataccggtgctcataaaatcaataataccattggacaagcc
ttactcgccaaacgtatggggaaaactcgagtgatcgcggaaacaggcgcgggtcaacat
ggcgttgcaactgctacagttgccgctaaatttgggtttcaatgcgttgtgtacatgggg
tcagaagacattaagcgtcaatccagtaatgtttatagaatgaaattgttaggtgctgaa
gtggtgcctgtcacttcaggatcaaagacgttgaaagatgctttaaatgaagcattgaga
gattgggtgagtcatgtcgacgacacgttttatattattggtactgttgcaggtccccat
ccttatcctcaaatggtaagagattttcaagcgattattggtgttgaagctcgagctcaa
catatggaaaaaacaggccatttgccagatgctttggtagcttgtgtcggaggtggatcc
aatgcaataggcttgttttatccctttttgaatgatcagtctgtcatgatttatggggtt
gaagcaggagggaaaggcatagaaaccggtgagcattcggcatctctgattgctggaaaa
cctggtgtgttacacggtaatagaacctatttattgtgtgatgagtatggacaggtgaaa
gacactcactcagtatcagccggtctggattatcctggagttgggcctgaacatgcttat
ttaaaagatactggacgggtcatttataaagcaataaatgattccgaggccatggatgcg
tttcgcctgttaactcatacggaaggaattattccagcattagaatctagccacgcggta
gcctatgccatacaattggctaaaaccatgtcaaaagaacaaagcatcatagtcaatcta
tctggtcgtggtgataaagatatgcatacagtagctgctattgacggtataacaatttaa

DBGET integrated database retrieval system