KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1539Help
Entry
lpg1539           CDS       T00199                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lpg1539
Enzymes [BR:lpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     lpg1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1704272..1704697
Genome map
AA seq 141 aa AA seqDB search
MNVCYLSLGSNQKNPERQIRQAINEIKQIPSTCLIKVSRLYWNKAWGFENQQEFCNVVIE
IRTTLLPHKLLKWCQKIENRHKRVRRKFWGPRTLDIDIILYGYRLIRTKNLIVPHPCFHL
RDFVLVPLRELNSNLKIPNYT
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttgctatctgagcttgggatcgaatcaaaaaaatcctgagcgtcaaataaga
caagccattaatgaaatcaaacagattccatcaacatgccttatcaaggtgtctcgctta
tattggaataaggcctggggctttgaaaatcaacaggaattttgtaatgtcgttatagag
atacgaactactctgttaccccataagctccttaagtggtgccagaaaatagaaaacagg
cacaagcgagtcaggagaaagttttgggggccaagaacattagatattgatatcatttta
tatggttatagattaattcgcacaaaaaacttaatcgttccacatccttgtttccattta
cgagattttgttcttgttcctctaagagaattaaactctaatttaaaaataccaaattac
acatag

DBGET integrated database retrieval system