KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1596Help
Entry
lpg1596           CDS       T00199                                 

Gene name
yfcX
Definition
enoyl CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpg1596 (yfcX)
   01212 Fatty acid metabolism
    lpg1596 (yfcX)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    lpg1596 (yfcX)
   00650 Butanoate metabolism
    lpg1596 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    lpg1596 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    lpg1596 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lpg1596 (yfcX)
   00310 Lysine degradation
    lpg1596 (yfcX)
   00380 Tryptophan metabolism
    lpg1596 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lpg1596 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    lpg1596 (yfcX)
   00281 Geraniol degradation
    lpg1596 (yfcX)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    lpg1596 (yfcX)
Enzymes [BR:lpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     lpg1596 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     lpg1596 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     lpg1596 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1762019..1764037)
Genome map
AA seq 672 aa AA seqDB search
MNNYKHWDLQRDKDAILWLGLNRRDAAVNSINEEVLDELNSLLHEISHDKKAMGLIIYSL
KEKGFIAGADVNAFSQFESSSQAVDFLQKGQTVFARLQALSIPSVAMIDGFCMGGGYELA
LACTYRIATDDKDTRIGLPEVMLGIHPGWGGTVRLPQLIGGFKALSQVILTGSAIPAAKA
KSLGMIDEVVPVRQLRRAAVYFIKNKPPRHRASFIESLTNSSLLRKAIAYLLRYNVAKRV
RKEHYPAPYAVIDLWEKEGGVGERAYLKEVDSIEKLVSQNDTAKNLIRAFLLRERLKGFA
KDSHFKATHVHVIGAGVMGGDIAAWCALRGLQVTLQDKSYEQIAPAIGRAHKLYSKKLRK
PRLIQAAMDRLIADPHGHGVKRADVIIEAVFENLVVKHEIMKTVEKNAKKDAIIATNTSS
IPLDEISSVMSKPERLVGIHFFNPVAKMDLVEIVSSSSTTKKVQQSACAFVNQIGKLPLP
VKSSPGFLINRVLMPYLMECVQLLDEGYSAETIDEAALQFGMFMGPVELADTVGMDVCLA
VAENLTSHFGGTIPQRLRDLVKEGKLGRKTGEGFYKYKNGKVIKKKAPSHVDKTIADRLI
LRMVNESAACIREKVVEDSDLLDAGMIFATGFAPFRGGPMNYANDFGKDKLETLFKTFES
KYGERFKVDTSL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaataattataaacattgggatttacaacgagataaagacgccattctgtggcttgga
ttaaatagaagggatgctgctgttaatagcattaatgaagaagtcctggatgagttaaac
agcttgctgcatgaaatatcgcatgataaaaaagcaatgggattaattatttattcgctc
aaggaaaaagggtttattgcgggtgctgatgttaacgctttttcacaatttgagagctct
tcacaagcggttgattttttgcagaaaggacaaactgtatttgctcggttgcaagcttta
tcaattccaagtgtcgcaatgatcgatggtttttgcatgggcggtggttatgagttagct
ttagcctgcacctaccgaatcgcaacggatgacaaagacacacgtattggtttgcctgaa
gtaatgctgggtattcatccagggtggggcggtactgtgcgtttgcctcagttaataggt
ggttttaaagctttatcacaagtcatattaaccggtagtgcaatacctgctgcaaaagct
aaaagcctcggtatgattgatgaggtagtacctgttcgtcagctaagaagggctgctgtt
tatttcataaagaataaaccaccacgacacagggcatcatttattgaaagtttaacgaat
agctctctgctcagaaaagctatcgcttatttactgcgttataacgtagccaagcgagtt
cgaaaagaacattatcctgcaccatatgccgtgattgacctgtgggaaaaagaaggagga
gtgggagagagggcttatcttaaagaagtggactctatagaaaaacttgtatcccaaaat
gataccgccaagaatcttatcagagcatttttattgcgtgagcgattaaaagggttcgcc
aaagacagccatttcaaagcgacccatgttcatgtgattggagcaggggttatgggaggg
gatatcgctgcctggtgtgctttgcgaggtcttcaggtcacattacaggataagtcttat
gaacaaattgcccctgcaatagggagggcacataaactttatagcaaaaaactgcgtaag
cctcgattgatccaggccgcaatggatagattaattgcagatccccatgggcatggggta
aaacgagcagatgtcattattgaggctgttttcgagaatttggttgttaagcatgaaata
atgaaaactgtggaaaaaaatgccaaaaaagatgcgatcatagcgacaaacacctctagt
atcccacttgatgaaatcagcagtgtaatgagtaaaccagaacgcttggtaggcattcat
ttctttaatcctgtagctaaaatggatttggtagaaatagtcagcagctcatctactaca
aaaaaagttcagcagagcgcttgcgcgttcgtcaatcaaattggcaaattgcctttgcct
gtcaaatcaagccctggatttttaataaatagagtgctcatgccttacctgatggagtgc
gtacagttattggatgaaggatatagtgcggagacaatagatgaggccgcattacagttt
ggtatgtttatgggccctgttgaactggctgatacagtaggaatggatgtttgtcttgct
gtggctgaaaatctgaccagtcactttggtggtactattccacaaagattacgtgattta
gtaaaagaaggtaagctaggcagaaaaactggagaaggtttttataaatataaaaatgga
aaagtaattaagaaaaaggctccatcacatgtcgataaaaccattgcagacagattaatt
ttgcgcatggtgaatgaatctgcagcttgtatacgtgagaaagtggttgaagattctgac
ttgttggatgctggaatgatctttgccacaggttttgctccattccgtggagggcctatg
aattacgcaaatgattttggtaaagataaactggaaactttatttaaaacatttgaatct
aaatacggcgaacgttttaaggtagataccagcttataa

DBGET integrated database retrieval system