KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1: lpg1596Help
Entry
lpg1596           CDS       T00199                                 

Gene name
yfcX
Definition
(RefSeq) enoyl CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1
Pathway
lpn00071  Fatty acid degradation
lpn00280  Valine, leucine and isoleucine degradation
lpn00281  Geraniol degradation
lpn00310  Lysine degradation
lpn00362  Benzoate degradation
lpn00380  Tryptophan metabolism
lpn00410  beta-Alanine metabolism
lpn00640  Propanoate metabolism
lpn00650  Butanoate metabolism
lpn00903  Limonene and pinene degradation
lpn00930  Caprolactam degradation
lpn01040  Biosynthesis of unsaturated fatty acids
lpn01100  Metabolic pathways
lpn01110  Biosynthesis of secondary metabolites
lpn01120  Microbial metabolism in diverse environments
lpn01130  Biosynthesis of antibiotics
lpn01200  Carbon metabolism
lpn01212  Fatty acid metabolism
Module
lpn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    lpg1596 (yfcX)
   00650 Butanoate metabolism
    lpg1596 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    lpg1596 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    lpg1596 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lpg1596 (yfcX)
   00310 Lysine degradation
    lpg1596 (yfcX)
   00380 Tryptophan metabolism
    lpg1596 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lpg1596 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    lpg1596 (yfcX)
   00281 Geraniol degradation
    lpg1596 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lpg1596 (yfcX)
   00930 Caprolactam degradation
    lpg1596 (yfcX)
Enzymes [BR:lpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     lpg1596 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     lpg1596 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     lpg1596 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 UDPG_MGDP_dh_N Pyr_redox_2 DAO She2p AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 19833161
NCBI-ProteinID: YP_095625
Pasteur: lpg1596
UniProt: Q5ZV44
Position
complement(1762019..1764037)
Genome map
AA seq 672 aa AA seqDB search
MNNYKHWDLQRDKDAILWLGLNRRDAAVNSINEEVLDELNSLLHEISHDKKAMGLIIYSL
KEKGFIAGADVNAFSQFESSSQAVDFLQKGQTVFARLQALSIPSVAMIDGFCMGGGYELA
LACTYRIATDDKDTRIGLPEVMLGIHPGWGGTVRLPQLIGGFKALSQVILTGSAIPAAKA
KSLGMIDEVVPVRQLRRAAVYFIKNKPPRHRASFIESLTNSSLLRKAIAYLLRYNVAKRV
RKEHYPAPYAVIDLWEKEGGVGERAYLKEVDSIEKLVSQNDTAKNLIRAFLLRERLKGFA
KDSHFKATHVHVIGAGVMGGDIAAWCALRGLQVTLQDKSYEQIAPAIGRAHKLYSKKLRK
PRLIQAAMDRLIADPHGHGVKRADVIIEAVFENLVVKHEIMKTVEKNAKKDAIIATNTSS
IPLDEISSVMSKPERLVGIHFFNPVAKMDLVEIVSSSSTTKKVQQSACAFVNQIGKLPLP
VKSSPGFLINRVLMPYLMECVQLLDEGYSAETIDEAALQFGMFMGPVELADTVGMDVCLA
VAENLTSHFGGTIPQRLRDLVKEGKLGRKTGEGFYKYKNGKVIKKKAPSHVDKTIADRLI
LRMVNESAACIREKVVEDSDLLDAGMIFATGFAPFRGGPMNYANDFGKDKLETLFKTFES
KYGERFKVDTSL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaataattataaacattgggatttacaacgagataaagacgccattctgtggcttgga
ttaaatagaagggatgctgctgttaatagcattaatgaagaagtcctggatgagttaaac
agcttgctgcatgaaatatcgcatgataaaaaagcaatgggattaattatttattcgctc
aaggaaaaagggtttattgcgggtgctgatgttaacgctttttcacaatttgagagctct
tcacaagcggttgattttttgcagaaaggacaaactgtatttgctcggttgcaagcttta
tcaattccaagtgtcgcaatgatcgatggtttttgcatgggcggtggttatgagttagct
ttagcctgcacctaccgaatcgcaacggatgacaaagacacacgtattggtttgcctgaa
gtaatgctgggtattcatccagggtggggcggtactgtgcgtttgcctcagttaataggt
ggttttaaagctttatcacaagtcatattaaccggtagtgcaatacctgctgcaaaagct
aaaagcctcggtatgattgatgaggtagtacctgttcgtcagctaagaagggctgctgtt
tatttcataaagaataaaccaccacgacacagggcatcatttattgaaagtttaacgaat
agctctctgctcagaaaagctatcgcttatttactgcgttataacgtagccaagcgagtt
cgaaaagaacattatcctgcaccatatgccgtgattgacctgtgggaaaaagaaggagga
gtgggagagagggcttatcttaaagaagtggactctatagaaaaacttgtatcccaaaat
gataccgccaagaatcttatcagagcatttttattgcgtgagcgattaaaagggttcgcc
aaagacagccatttcaaagcgacccatgttcatgtgattggagcaggggttatgggaggg
gatatcgctgcctggtgtgctttgcgaggtcttcaggtcacattacaggataagtcttat
gaacaaattgcccctgcaatagggagggcacataaactttatagcaaaaaactgcgtaag
cctcgattgatccaggccgcaatggatagattaattgcagatccccatgggcatggggta
aaacgagcagatgtcattattgaggctgttttcgagaatttggttgttaagcatgaaata
atgaaaactgtggaaaaaaatgccaaaaaagatgcgatcatagcgacaaacacctctagt
atcccacttgatgaaatcagcagtgtaatgagtaaaccagaacgcttggtaggcattcat
ttctttaatcctgtagctaaaatggatttggtagaaatagtcagcagctcatctactaca
aaaaaagttcagcagagcgcttgcgcgttcgtcaatcaaattggcaaattgcctttgcct
gtcaaatcaagccctggatttttaataaatagagtgctcatgccttacctgatggagtgc
gtacagttattggatgaaggatatagtgcggagacaatagatgaggccgcattacagttt
ggtatgtttatgggccctgttgaactggctgatacagtaggaatggatgtttgtcttgct
gtggctgaaaatctgaccagtcactttggtggtactattccacaaagattacgtgattta
gtaaaagaaggtaagctaggcagaaaaactggagaaggtttttataaatataaaaatgga
aaagtaattaagaaaaaggctccatcacatgtcgataaaaccattgcagacagattaatt
ttgcgcatggtgaatgaatctgcagcttgtatacgtgagaaagtggttgaagattctgac
ttgttggatgctggaatgatctttgccacaggttttgctccattccgtggagggcctatg
aattacgcaaatgattttggtaaagataaactggaaactttatttaaaacatttgaatct
aaatacggcgaacgttttaaggtagataccagcttataa

DBGET integrated database retrieval system